KEGG   Streptomyces sp. PAMC 26508: F750_4341Help
Entry
F750_4341         CDS       T02619                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00564  Glycerophospholipid metabolism
strp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    F750_4341
Enzymes [BR:strp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     F750_4341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGJ56782
UniProt: M9TWY5
LinkDB All DBs
Position
4505315..4507021
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTEALAAMAERELDVLVVGAGVVGAGTVLDAVTRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLTRRHALRVAPALRKDALVGALQYYDAQMDDARF
VANLVRTAASYGAHVANGARVTGFLREGERVVGARVQDVEGGAEYEIRAKQVVNATGVWT
DDTQALIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLNTPLGRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPAPGLVVVAGGKYTTYRVMAKDAVDEAVHALDRRVADCVTEDIPLLGAEGYRAL
WNARARIADRTGLHVVRVEHLLNRYGSMTEELLELVKGDSSLGEPLTGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCARECADLMAPVLGWDTDRIEREVEHYRKRV
EAERESQRQPDDLTADAARLGAPDIVPR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgcggagcgcaccgaggcgctggccgcgatggccgag
cgcgaactggacgtgctggtcgtgggagcgggcgtggtaggcgccgggaccgtgctggac
gcggtcaccagaggactttccaccggactggtcgaggcgcgggactgggcgtccggcacg
tccagcaggtcgagcaagctgatccacggcggactgcgctatctggagatgctggacttc
gcgctcgtccgcgaggcgctcaaggagcgcgggctgctcctggagcggctggcgccccac
ctggtcaagcccgttcccttcctctaccccttgcagcacaagggctgggagcggctgtac
gccggctcgggcgtcgcgctgtacgacgcgatgtcggtgtcctcgggacacggccgcggg
ctgcccgtgcaccggcacctcacacgccgccacgccctgcgggtcgctccggccctgcgc
aaggacgccctggtcggagccctgcagtactacgacgcccagatggacgacgcgcggttc
gtcgcgaacctcgtgcgcacggccgcgagctacggcgcacacgtggcgaacggggcgcgg
gtgaccggtttcctgcgggagggcgagcgggtcgtcggcgcgcgggtgcaggacgtcgag
ggcggcgccgagtacgagatccgggccaagcaggtcgtcaacgcgaccggcgtgtggacc
gacgacacccaggccctcatcggcgagcgcgggcagttccacgtccgggcgtcgaagggc
atccacctcgtcgtgcccaaggaccgcatccactcgtcgaccggactcatcctgcggacc
gagaagtccgtgctcttcgtgatcccgtggggacggcactggatcatcggcacgaccgac
accgactgggacctggacaaggcccacccggcggcctccagcgccgacatcgactatctg
ctcgaacatgtgaactcggtgctcaacaccccgctcggcagggacgacgtcgagggcgtc
tacgccgggctccggcccctgctggccggtgagtcggacgccaccagcaagctctcgcgg
gagcacacggtggcccacccggcgccgggactcgtcgtcgtggcgggcgggaagtacacg
acgtaccgggtgatggcgaaggacgccgtcgacgaggccgtgcacgcgctcgaccggcgg
gtggcggactgcgtcaccgaggacatcccgctgctgggggccgagggctaccgcgccctg
tggaacgcccgcgccaggatcgccgaccgcaccgggctgcacgtcgtccgggtggagcac
ctgctcaaccgctacggctcgatgaccgaggaactcctcgaactcgtgaagggcgactcg
tcgctgggagaacccctcacgggtgccgaggactacctgcgtgccgaggtcgtctacgcc
gcctcgcacgagggtgcccgccacctcgacgacgtcctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccgctgtgcccgcgagtgcgcggacctgatggcaccg
gtgctcggctgggacaccgaccggatcgaacgggaggtggagcactaccgcaagcgcgtg
gaggccgagcgtgagtcccagcggcagccggacgacctgacggccgacgcggcgcggctg
ggggcgccggacatcgtgccgcgctga

DBGET integrated database retrieval system