KEGG   Streptomyces sp. PAMC 26508: F750_5104Help
Entry
F750_5104         CDS       T02619                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00473  D-Alanine metabolism
strp00550  Peptidoglycan biosynthesis
strp01100  Metabolic pathways
strp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F750_5104
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F750_5104
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    F750_5104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:strp01011]
    F750_5104
Enzymes [BR:strp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     F750_5104
Peptidoglycan biosynthesis and degradation proteins [BR:strp01011]
 Precursor biosynthesis
  Amino acid ligase
   F750_5104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGJ57537
LinkDB All DBs
Position
5308369..5309553
Genome map
AA seq 394 aa AA seqDB search
MSSQNLPQSPEGPLSSEQRSEPGRKPRVAVVFGGRSSEHGISVVTAGAVMSALDRTKYDV
LPIGITRDGRWVLTSDDPARMAISDRQVPDVDQLAGSARGAVALSVDPGNRDVVVGEPGS
VPEVLGEVDVVFPVLHGPYGEDGTLQGFLELSGVPYVGAGVLSSAVGQDKEYMKRVFVSF
GLPVGPYEVVRPREWDTDRPAARKRVMEFAAEHGWPLFVKPARGGSSMGITKVDDAAGLD
EAIEEARRHDPKFLVESLLSGREIECGVLEFEDGPRASVPAEIPPVTAHDFYDFEAKYID
SAAGLVPAPLTDEQTAQVQRLAVEAFEAASCEGLVRADFFLTDDGSFVINEINTMPGFTP
ISMFPRMWQASGVEYPELVDRLITAALNRSTGLR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagaacctcccccagagccctgagggccccctgagctccgagcagcgctcc
gagccgggccgcaagccgcgtgtggccgtcgtgttcggcggccggagctccgaacacggc
atctcggtcgtcacggccggcgccgtcatgagcgccctcgaccggacgaagtacgacgtc
ctgccgatcggtatcaccagggacggacggtgggtcctcacgtccgacgatccggcccgc
atggccatctcggaccgccaggtgcccgacgtggaccagctcgccgggtccgcacgcggc
gccgtggcgctctccgtcgacccggggaaccgtgacgtcgtcgtgggcgaacccggttcg
gtgcccgaggtcctgggggaggtcgacgtcgtcttccccgtgctgcacggcccctacggc
gaggacggcacgctccaggggttcctggagctgtccggcgtgccgtacgtcggcgcgggt
gtcctgtcctcggccgtcggccaggacaaggagtacatgaagcgggtgttcgtctccttc
ggcctgccggtcggcccgtacgaggtcgtccgcccccgggaatgggacacggaccgcccg
gccgcccgcaagcgcgtcatggagttcgcggccgaacacggctggccgctcttcgtgaag
ccggcccgcggcggctcctccatgggcatcaccaaggtcgacgacgcggccggtctcgac
gaggcgatcgaggaggcccgccggcacgaccccaagttcctcgtggagtccctgctgagc
ggccgggagatcgagtgcggcgtgctggagttcgaggacggaccgcgcgccagcgtgccc
gccgagatcccgcccgtcaccgcgcacgacttctacgacttcgaggccaagtacatcgac
tcggcggccggtctggttcccgctccgctcaccgacgagcagaccgcccaggtgcagcgg
ctcgccgtcgaggcgttcgaggccgcctcctgcgagggcctggtgcgcgccgacttcttc
ctcaccgacgacggctcgttcgtcatcaacgagatcaacaccatgccgggattcactccg
atctcgatgttcccccgcatgtggcaggcgagcggggtggagtacccggagctggtggac
cggctgatcacggcggcgctgaaccgctccaccggcctgcgctga

DBGET integrated database retrieval system