KEGG   Streptomyces sp. PAMC 26508: F750_6091Help
Entry
F750_6091         CDS       T02619                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    F750_6091
Enzymes [BR:strp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     F750_6091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AGJ58518
UniProt: M9TZ48
LinkDB All DBs
Position
complement(6492325..6494301)
Genome map
AA seq 658 aa AA seqDB search
MPSLHDAARGRILFGGDYNPEQWPEEVWADDVRLMEEAGVNSVTVGVFSWAMIEPRPGAR
EFGWLDRLLDLLAAHGISAVLATPTSSPPPWMGALHPETLPRTEDGALVNYGSRQHFCPS
SPVYRRYAAALTEDLAARYADHPALTVWHINNEYCTHCWCDETAGHFRRWLGSRYTTLDA
LNDAWGTAFWSQRYDTWAEILPPRRAQYMRNPAQELDFKRFTSDALMECYTAERDIVARH
TPHIPVTTNFMPLWSGQDAWAWAEQEDIVSVDVYPDPTDPHGGQYNAMLADMTRSQARGP
WMVMEQAAGPVNWRDVNHPKPAGLNRLWSLQAVARGADALCYFQWRQSRQGAEKFHSGML
SHAGEEGRTFREVRRIGAELALIGAEVSGTEVTADVAVLHDWDAWWSSTQQGRPSSLVSY
TELVQTWHRGLWESGISTEFARPGGDLSAYRMVLVPQLQLLGDAAVDNLVAYVRGGGTLV
CGFFTGVVDTDDRIRPGGMDARLRELFGIRTVHEWWPLDAGATVGCDGFDGTLWSEELEP
DGSAETVAAYRGGELDGLPAVLRKGTAWYVSTLPGPEALRGLLGRVAADAGVRPVLEGLP
PGVEAVRRGALLFLLNHGRSPAAVELPGRYVDLLTGDAADGGVELERYGVAVLGDVRA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccctgcacgacgccgcccgtggccgcatccttttcggaggcgactacaacccc
gagcagtggcccgaggaggtgtgggccgacgacgtccggctgatggaggaggccggggtc
aactccgtcaccgtcggcgtcttctcctgggcgatgatcgaaccgcgtcccggggcgcgg
gagttcggctggctggaccggcttctggacctcctggccgcccacgggatctcagccgtg
ctcgccacgcccacctcgtcccctcctccgtggatgggcgccctgcacccggagacgctg
ccgcgtaccgaggacggcgcgctggtcaactacggttcccggcagcatttctgcccgagc
tcgccggtctaccggcgctatgcggccgcgctcaccgaggacctggcggcacggtacgcg
gaccatccggcgctcaccgtgtggcacatcaacaacgagtactgcacgcactgctggtgc
gacgagaccgccggtcacttccgccgctggctgggctcccgctacaccaccctggacgcg
ctgaacgacgcgtggggcacggcgttctggagccagcgctacgacacgtgggcggagatc
ctgccgccgcgccgggcgcagtacatgcgcaaccccgcgcaggagctggacttcaagcgg
ttcacctcggacgccctgatggagtgctacaccgccgagcgggacatcgtcgcccggcac
accccgcacatcccggtgacgaccaacttcatgccgctgtggtcgggccaggacgcctgg
gcctgggcggagcaggaggacatcgtctccgtcgacgtctacccggatcccacggacccg
cacggcgggcagtacaacgcgatgctcgccgacatgacccgttcccaggcacgcggaccg
tggatggtgatggagcaggccgcggggccggtgaactggcgcgacgtcaaccaccccaag
ccggcgggcctcaaccggctgtggtcgctgcaggccgtggccaggggcgcggacgccctc
tgctacttccagtggcggcagtcccggcagggtgccgagaagttccactccgggatgctg
agccacgcgggtgaggaagggcgcaccttccgggaggtcaggcgcatcggtgccgaactc
gccctcatcggcgccgaggtcagtggtaccgaggtgaccgccgacgtcgccgtgctccac
gactgggacgcctggtggtcgagcacccagcagggcaggccgtcctccctcgtctcgtac
acggagctcgtgcagacctggcaccgggggctgtgggagagcgggatcagcacggagttc
gcccgccccggcggcgacctgagcgcctaccgcatggtgctcgtgccccagctccagctc
ctcggcgacgccgccgtcgacaacctcgtcgcgtacgtccggggaggcggcaccctggtg
tgcgggttcttcaccggagtcgtggacacggacgaccggatcaggccgggcggcatggac
gccaggctgcgtgagctgttcggcatccgcacggtgcacgagtggtggccgctggacgcg
ggggcgaccgtggggtgcgacggcttcgacggcaccctgtggtcggaggagctggagccc
gacggcagcgcggagaccgtggccgcgtaccgagggggtgagctggacgggcttccggcg
gtactccgcaaggggaccgcctggtacgtctcgacgctccccgggcccgaggccctgcgc
ggtctgctcggccgggtggcggcggacgccggtgtgcgccccgtcctggagggactgccc
ccgggggtggaggcggtccggcgcggcgcgctgctgttcctgctgaaccacggccggtcc
cccgccgcggtggagctgccgggccgctacgtcgacctgctcacgggcgacgccgccgac
ggcggcgtggagctggagcgctacggcgtggccgtgctcggagacgtccgcgcatga

DBGET integrated database retrieval system