KEGG   Streptomyces sp. PAMC 26508: F750_6323
Entry
F750_6323         CDS       T02619                                 

Definition
(GenBank) hypothetical protein
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00331  Clavulanic acid biosynthesis
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
Module
strp_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:strp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    F750_6323
Enzymes [BR:strp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     F750_6323
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase TetR_C_22 QueC
Other DBs
NCBI-ProteinID: AGJ58748
LinkDB
Position
complement(6741716..6743170)
AA seq 484 aa
MFATRGAHESVAEALRNQTFDAVLVHSGSPGDAVARAGDTALVLAGELYNREELLTLLPS
GGDVRTDAQLVLALLGIYDLHAFRLLNGRFAAAAALGDRLLLATDHAGSVPLYTLPAPGR
VLAATEIKALVPATAGTPPAGRPVADARRVRRVPGVHQVPAGTVLDLDVRTGTAVPHRTW
APALSRYVRSEADATDAVRRTLERAVEARTGGTTPLVVLSGGIDSSGVAALAAAHTDGPL
DTLSMGTDTANEFAEARVVATHLGSAHREITVPTADLLGQLPYAIWASESVDPDIIEYLL
PLTALYRALDGPARRILTGYGADIPLAGMHREDRLPQLDTAVAFDMATFDGLNEMTPVLS
GIQGHWSTHPYWDRDVLDLLVPLEAGLKRRYGRDKWVLREAMSALLPQETVTRPKLGVHE
GSGTTSSFSLLLMDAGVPDADVHRAKSLVVREIFDRVVVEGLPPAEVRTADAVHQVAARL
KETE
NT seq 1455 nt   +upstreamnt  +downstreamnt
gtgttcgccacccggggcgcccacgaatccgtggccgaggccctccgcaaccagaccttc
gacgccgtgctcgtccactcgggttcgcccggggacgccgtggcccgcgccggtgacacg
gcgctcgtcctggccggcgagctctacaacagggaggagctgctcaccctcctcccgtcc
ggcggcgacgtccgcacggacgcgcagctcgtgctcgctctcctgggcatctacgacctg
cacgcgttccggctgctcaacggccggttcgcggcggccgccgccctcggtgaccggctg
ctcctggccaccgaccacgcgggttccgtcccgctctacacccttccggcgccggggcgc
gtcctcgccgccaccgagatcaaggccctcgtcccggcgacggcggggacgccgcccgcc
gggcggcccgtcgccgacgcgcgccgggtgcgccgcgtaccgggggtccaccaggtgccc
gccggcacggtcctggacctggacgtccgtacgggcaccgccgtgccccaccggacctgg
gcgcccgctctgtcacggtatgtacggtccgaggccgacgccaccgacgcggtgcgcagg
actctggagcgggcggtcgaggcgcgcacgggtggcaccacgccactggtggtgctctcc
gggggaatcgattcttcaggagtcgccgcgctcgccgccgcccacacggacggccccctg
gacaccctgtccatggggaccgacaccgcgaacgagttcgccgaggcccgcgtggtcgcg
acccacctcggctccgcgcaccgggagatcaccgtcccgaccgcggacctgctcggtcag
ctgccctacgcgatctgggcgtccgagtccgtcgacccggacatcatcgagtacctgctg
ccgctcaccgccctgtaccgggcgctcgacggtccggcccgccggatcctcaccggctac
ggggccgacatcccgctcgccgggatgcaccgcgaggaccggctgccccagctggacacc
gccgtggcgttcgacatggccacgttcgacgggctcaacgagatgactccggtgctctcc
ggcatccagggccactggtcgacgcacccgtactgggaccgcgacgtactggacctgctg
gtgcccctggaggccgggctcaaacgccgctacggccgcgacaagtgggtcctgcgcgag
gcgatgagcgccctgctcccgcaggagaccgtcaccaggccgaagctcggcgtgcacgag
ggctccggaacgacgtcctccttcagcctgctgctgatggacgccggggtgccggacgcc
gacgtccacagggccaagtccctggtggtgcgggagatcttcgaccgggtggtcgtcgaa
ggactgccgcccgccgaggtgcgcaccgccgacgcggtccaccaggtggccgcacgcctg
aaggagaccgagtga

DBGET integrated database retrieval system