KEGG   Streptomonospora sp. M2: EKD16_01800Help
Entry
EKD16_01800       CDS       T05863                                 

Definition
(GenBank) cobyric acid synthase
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00550  Peptidoglycan biosynthesis
strr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EKD16_01800
Enzymes [BR:strr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     EKD16_01800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: QBI52177
UniProt: A0A4P6Q0V8
LinkDB All DBs
Position
386673..387383
Genome map
AA seq 236 aa AA seqDB search
MSDTSSVLRIVWIYPDLLSTYGDQGNALILRRRAEQRGIRTEIVHVHSSDPVPAEGDVYL
LGGGEDRPQILAADRLRSDGGLKRAVERGAAVLAVCAGYQIIGETYGDDDDKPLPGVGIL
DVRSGRGESRAVGEIVAEVAPEMGGGRITGFENHQGRTTLGPGATPLSRTLTGIGNDGRT
EGAFQDQVVGTYLHGPALPRNPQLADLMLRMRVGELAPLPPSWGETLHQERLAAAL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacaagcagcgtcctgcgcatcgtgtggatctatcccgacctgctgagcacc
tacggcgaccagggcaacgcgctgatcctgcgccgccgcgccgagcagcgcggaatccgc
accgagatcgtgcacgtgcactccagcgacccggtcccggccgagggcgacgtctacctc
ctcggcggtggcgaggaccgaccgcagatcctcgccgccgaccggctgcgctccgacggc
ggcctcaagcgcgccgtcgaacgcggcgccgcggtgctggcggtctgcgcgggttaccag
atcatcggcgagacctacggtgacgacgacgacaagccgctgccgggcgtgggcatcctg
gacgtccgcagcggacgcggcgagagccgcgcggtaggcgagatcgtcgccgaggtcgcc
ccggagatgggcggcggccgcatcaccggcttcgagaaccaccagggccgcaccacgctg
gggcccggagccaccccgctgtcgcgcaccctcaccggaatcggcaacgacggccgcacc
gagggcgccttccaggaccaggtcgtcggcacctacctgcacggccccgccctgccgcgc
aatccgcaactggccgacctgatgctgcgcatgcgcgtcggcgaactggccccgctgccc
ccctcctggggcgagaccctgcaccaggagcgcctggccgcggcgctgtag

DBGET integrated database retrieval system