KEGG   Streptomonospora sp. M2: EKD16_03745Help
Entry
EKD16_03745       CDS       T05863                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00020  Citrate cycle (TCA cycle)
strr00190  Oxidative phosphorylation
strr00650  Butanoate metabolism
strr01100  Metabolic pathways
strr01110  Biosynthesis of secondary metabolites
strr01120  Microbial metabolism in diverse environments
strr01130  Biosynthesis of antibiotics
strr01200  Carbon metabolism
Module
strr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKD16_03745 (sdhA)
   00650 Butanoate metabolism
    EKD16_03745 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EKD16_03745 (sdhA)
Enzymes [BR:strr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EKD16_03745 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     EKD16_03745 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_oxidored HI0933_like DAO GIDA FAD_binding_3 Pyr_redox_3 Thi4 Lycopene_cycl NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QBI52559
UniProt: A0A4P6Q175
LinkDB All DBs
Position
complement(840880..842814)
Genome map
AA seq 644 aa AA seqDB search
MSETTRHSYDVVVIGAGGAGLRAAIEARQQGKRTAVISKSLFGKAHTVMAEGGAAASLGN
VNSDDRWQVHFRDTIRGGKFMNNPRMAELHAKESPQRILELEHWGALFDRTSDGRISQRN
FGGHEYPRLAHVGDRTGLEMIRTLQQRVVQLQQADAAEFGDAEAMLRVFAETTVTELLLE
GEPGAEGGRIAGAFGYIRETGDYVVFEAPAVVLATGGIGRSFKVTSNSWEYSGDGHALAL
RAGAALLNMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLRNSEGSRFMFDYVPDVFRE
HYAETEEEADGWYADPASNRRPPELLPRDEVSRAINNEVKQGRGSPHGGVFLDVSTRLPA
EEIMRRLPSMHHQFKELADVDITAGPMEVGPTCHYVMGGVEVDADTGASSVPGLFAAGEV
AGGMHGSNRLGGNSLSDLLVFGRRCGLGASAYLDELGEERPTPEAADIDRLSEEAAAPLG
RETGENPYQLHQEIQQTMNDLVGIIRRGNEMEQALESLDKLRERVAAVRSEGGSVYNPGW
HLALDLRNMLLVSETVARAALERQESRGGHTRDDYPAMSAEWRAVNLIVSLRDGRLQLRH
QPIDAMREDLMELFEREELGKYLTEEELPPAPRSDGSETAKEDN
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacaacacggcacagctacgacgtcgtcgtgatcggggccggcggcgccggc
ctgcgcgcggcgatcgaggcgcgccagcagggcaagcggaccgccgtcatctccaagtcc
ctgttcggcaaggcccacaccgtcatggccgagggcggcgccgccgcgtcgctgggcaac
gtcaacagcgacgaccgctggcaggtgcacttccgcgacaccatccgcggcgggaagttc
atgaacaacccccgcatggccgaactgcacgccaaggagtcgcctcagcgcatcctggag
ctggagcactggggcgccctgttcgaccgcacctccgacggccgcatcagccagcgcaac
ttcggcggccacgagtacccgcgcctggcccacgtcggcgaccgcaccggcctggagatg
atccgcaccctgcagcagcgcgtggtccagctgcagcaggccgacgccgccgagttcggc
gacgcggaggcgatgctgcgcgtattcgccgagaccaccgtcaccgaactgctgctggag
ggcgaaccgggagcggagggcggccgtatcgccggcgccttcggctacatccgcgagacc
ggcgactacgtcgtcttcgaggccccggcggtcgtcctcgccaccggcggcatcggccgg
tccttcaaggtcacttccaactcctgggagtacagcggcgacggccacgccctggcgctc
cgcgccggcgccgcgctgctgaacatggagttcgtgcagttccaccccaccggcatggtc
tggccgccgtcggtgaaggggatcctggtcaccgaatcggtgcgcggcgacggcggggtg
ctgcgcaactccgagggcagccggttcatgttcgactacgtgcccgacgtcttccgcgag
cactacgccgagacggaggaggaggccgacggctggtacgccgacccggcaagcaaccgc
cgcccgcccgagctgctgccccgcgacgaggtctcccgggccatcaacaacgaggtcaag
cagggccgcggatcgccgcacggcggcgtgttcctggacgtgtccacccggctgccggcc
gaggagatcatgcggcggctgccgtcgatgcaccaccagttcaaggagctggccgacgtc
gacatcacggccgggcccatggaggtcgggcccacctgccattacgtcatgggcggggtc
gaggtcgacgccgacaccggtgcgtcctcggtgcccggcctgttcgccgcgggcgaggtg
gccggcgggatgcacggctccaaccggctgggcggcaactcgctttcggacctgctggtg
ttcgggcggcgctgcggcctgggcgcctccgcctacctggacgaactcggcgaagagcgg
ccgactcccgaggccgccgacatcgaccgcctcagcgaggaggccgccgcccccttgggg
cgcgagaccggggagaacccctaccagctgcaccaggagatccagcagaccatgaacgac
ctcgtcggcatcatccggcgcggcaacgagatggagcaggccctggagtccctggacaag
ttgcgcgaacgcgtcgccgcggtgcgctccgagggcggcagcgtctacaaccccggctgg
cacctggccctggatctgcgcaacatgctgctcgtctcggagaccgtcgcccgcgccgcg
ctggagcgccaggagtcgcgcggcggccacacccgcgacgactacccggccatgtccgcc
gagtggcgggcggtcaacctgatcgtgtcgctgcgcgacggccgcctccagctgcgccac
cagccgatcgacgcgatgcgcgaggacctgatggagctgttcgagcgcgaggagctcggc
aagtacctcaccgaggaggagctgcccccggcaccgcggtccgacggctccgagaccgcg
aaggaggacaactga

DBGET integrated database retrieval system