KEGG   Streptomonospora sp. M2: EKD16_03765Help
Entry
EKD16_03765       CDS       T05863                                 

Gene name
frdA
Definition
(GenBank) Fumarate reductase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00020  Citrate cycle (TCA cycle)
strr00190  Oxidative phosphorylation
strr00650  Butanoate metabolism
strr01100  Metabolic pathways
strr01110  Biosynthesis of secondary metabolites
strr01120  Microbial metabolism in diverse environments
strr01130  Biosynthesis of antibiotics
strr01200  Carbon metabolism
Module
strr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKD16_03765 (frdA)
   00650 Butanoate metabolism
    EKD16_03765 (frdA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EKD16_03765 (frdA)
Enzymes [BR:strr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EKD16_03765 (frdA)
    1.3.5.4  fumarate reductase (quinol)
     EKD16_03765 (frdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 NAD_binding_8 GIDA HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QBI52563
UniProt: A0A4P6PWV4
LinkDB All DBs
Position
845846..847786
Genome map
AA seq 646 aa AA seqDB search
MSDLYIEGAEIRDEKAPEGPIAERWDKRRFSAKLVNPANRRKLSVIIVGTGLAGASAAAT
LGEAGYQVKSFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIYRLFYDTVKGGDFRSRES
NVYRLSQVSVEIIDQCVAQGVPFAREYGGLLDNRSFGGVQVSRTFYARGQTGQQLLIGAY
QALERQVTAGTVEMNTRHEMLELIVVDGRARGIIARDMVTGEIETHFADAVVLATGGYGN
VFYLSTNAMGCNVTASWRAHRKGAHFANPCYTQIHPTCIPVSGDYQSKLTLMSESLRNDG
RIWVPQEAGDSRDPREIPEDERDYYLERIYPAFGNLVPRDIASRAAKNVCDEGRGVGPGG
LGVYLDFADAIKRMGRPAVEAKYGNLFDMYQRITGENPYEVPMRIYPAVHYTMGGLWVDY
DLQSSVPGLFVTGEANFSDHGANRLGASALMQGLADGYFVLPNTINDYLAAGPFDQLDES
HPQAQAAADAVRARIDKLLSVKGDRTVDSFHKELGHIMWDYCGMERNEEGLRKAVERIRE
LRQEFWQNVRVLGKNEELNQALEKAGRVADFFELAELMCIDALHRNESCGGHFRSESQTE
DGEALRHDDEYAYVAAWEFGGTGEQPVLHKEPLEYEYVEMKQRSYK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgtacatcgaaggcgctgaaatccgcgacgagaaggcgcccgaggggccc
atcgcggagcgctgggacaagcgccgcttctccgccaagctggtcaaccccgccaaccgc
cgcaagctgtcggtcatcatcgtcggcaccggcctggcgggcgcgtcggccgccgccact
ctgggcgaggccgggtaccaggtgaagtccttctgctaccaggacagcccgcggcgcgcg
cacagcatcgccgcgcagggcggtatcaacgcggccaagaactaccgcaacgacggcgac
agcatctaccggctgttctacgacacggtcaagggcggcgacttccgctcgcgcgagtcc
aacgtctaccgcctctcccaggtcagcgtcgagatcatcgaccagtgcgtggcccagggc
gtccccttcgcccgcgagtacggcggcctgctggacaaccgctccttcggcggcgtccag
gtctcgcgcaccttctacgcgcgcgggcagacgggccagcagctgctcatcggcgcctac
caggccctggagcgccaggtcaccgcgggcaccgtcgagatgaacacccgccacgagatg
ctggagctgatcgtcgtcgacggccgggcgcgcggcatcatcgcgcgcgacatggtcacc
ggcgagatcgagacgcacttcgccgacgccgtcgtgctcgccaccggcggctacggcaac
gtcttctacctctcgaccaacgccatggggtgcaacgtcaccgcatcctggcgggcgcac
cgcaagggcgcgcacttcgccaacccctgctacacccagatccaccccacgtgcatcccc
gtcagcggcgactaccagtccaagctgacgctgatgagcgagtcgctgcgcaacgacggc
cgcatctgggtgccccaggaggccggcgacagccgcgacccgcgggagatccccgaggac
gagcgcgactactacctggagcgcatctaccccgcattcggcaacctggtgccgcgcgac
atcgcctcgcgcgccgccaagaacgtctgcgacgaggggcgcggcgtcggacccggcggg
ctgggcgtctacctggacttcgccgacgcgatcaagcgcatgggccggcccgccgtcgag
gcgaagtacggcaacctcttcgacatgtaccagcgcatcaccggcgagaacccctacgag
gtgccgatgcgcatctaccccgcggtgcactacaccatgggcgggctgtgggtcgactac
gacctgcagagctccgtgcccggactgttcgtgaccggtgaggccaacttctccgaccac
ggcgccaaccgcctgggcgccagcgcgctcatgcagggcctggccgacggctacttcgtg
ctgcccaacaccatcaacgactacctggcggcgggccccttcgatcagctcgacgagagc
catccccaggcccaggcggccgccgacgcggtgcgcgcccgcatcgacaagctcctctcg
gtcaagggggaccgcaccgtcgactccttccacaaggagctcggccacatcatgtgggac
tactgcggcatggagcgcaacgaggagggcctgcgcaaggccgtcgaacgcatccgcgag
ctgcgccaggagttctggcagaacgtccgggtgctgggcaaaaacgaggagctgaaccag
gcactggagaaggccggccgggtcgccgacttcttcgagctcgccgagctgatgtgcatc
gacgcgctgcaccgcaacgagtcgtgcggcgggcacttccgctccgagagccagaccgag
gacggcgaggcgctgcgccacgacgacgagtacgcctatgtcgccgcatgggagttcggc
ggaacgggcgagcagcccgtcctgcacaaggaacccctggaatacgaatacgtcgagatg
aagcagcggagctacaagtga

DBGET integrated database retrieval system