KEGG   Streptomonospora sp. M2: EKD16_03770Help
Entry
EKD16_03770       CDS       T05863                                 

Gene name
frdB2
Definition
(GenBank) Fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00020  Citrate cycle (TCA cycle)
strr00190  Oxidative phosphorylation
strr00650  Butanoate metabolism
strr01100  Metabolic pathways
strr01110  Biosynthesis of secondary metabolites
strr01120  Microbial metabolism in diverse environments
strr01130  Biosynthesis of antibiotics
strr01200  Carbon metabolism
Module
strr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKD16_03770 (frdB2)
   00650 Butanoate metabolism
    EKD16_03770 (frdB2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EKD16_03770 (frdB2)
Enzymes [BR:strr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EKD16_03770 (frdB2)
    1.3.5.4  fumarate reductase (quinol)
     EKD16_03770 (frdB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_10 Fer4_9 Fer4_2 Fer4 Fer4_6 Fer4_18 Fer4_16 Fer4_4 Fer4_13 Fer4_21 Fer4_15 Fer2 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: QBI52564
LinkDB All DBs
Position
847783..848532
Genome map
AA seq 249 aa AA seqDB search
MNITLRVWRQKGPDDKGRMVTYKVEDVSPDMSFLEMLDVLNEQLTLEGEEPVAFDHDCRE
GICGACGVVIDGEAHGPETTTTCQLHMRSFSDGDTITVEPWRAKAFPVIKDLVVDRSSFD
RIIQAGGYISAPTGTAPDAHAMPVPKADADRAFDAATCIGCGACVAACPNASAMLFTAAK
VTHLDMLPQGQPEREARVVQMVNQHDEEDFGGCTNIGECSAVCPKGIPLDTISQLNRDLL
GSLTSGGPE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcaccctgcgcgtgtggcgccagaagggccccgacgacaaggggcggatggtc
acctacaaggtcgaggacgtctcgcccgacatgtccttcctggagatgctcgacgtcctc
aacgagcagctcaccctggagggtgaggagccggtggccttcgaccacgactgccgcgag
gggatctgcggcgcctgcggcgtcgtcatcgacggcgaggcgcacggccccgaaaccacc
acgacctgccagctgcacatgcgcagcttctccgacggcgacaccatcaccgtcgagccg
tggcgggccaaggcgtttccggtcatcaaggacctggtcgtggaccgcagctccttcgac
cggatcatccaggccggcggctacatcagtgcgccgaccggtaccgcccccgacgcccac
gccatgccggtgcccaaggccgacgccgaccgcgcgttcgacgcggccacctgcatcggc
tgcggcgcgtgcgtcgcggcctgccccaacgcctcggcaatgctgttcaccgcggcgaag
gtcacccatctggacatgctgccgcagggccagcccgagcgcgaggcccgcgtcgtgcag
atggtgaaccagcacgacgaggaggacttcggcggctgcaccaacatcggagagtgctcc
gcggtgtgccccaagggcatcccgctggacacgatctcccagctcaaccgcgacctgctg
gggtcgctgacgagcggcggcccggagtag

DBGET integrated database retrieval system