KEGG   Streptomonospora sp. M2: EKD16_07660
Entry
EKD16_07660       CDS       T05863                                 

Definition
(GenBank) Trans,polycis-polyprenyl diphosphate synthase ((2Z,6E)-farnesyl diphosphate specific)
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00900  Terpenoid backbone biosynthesis
strr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EKD16_07660
Enzymes [BR:strr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     EKD16_07660
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QBI53328
UniProt: A0A4P6PYL7
LinkDB
Position
1773029..1773865
AA seq 278 aa
MSLFNTSSTASANRPPNPHPSGARPPELPKELIPQHVAIVMDGNGRWAKERGLARTEGHR
AGESSLFDVVEGALELGVGHLSAYAFSTENWKRSPDEVRFLMGFNREVIRRRRDELHAMG
VRVRWAGRRGRLWKSVISELEDAEEMTKHNTALTLQFCVNYGGRAEIADAAAALARKAAE
GRLNPDRITEAMLAKHLDEPDIPDVDLFLRSSGEQRTSNFLLWQSAYAEMVFLDTLWPDF
DRRHFWHACQVYASRDRRYGGAVPNPVEPRPTTTEEAR
NT seq 837 nt   +upstreamnt  +downstreamnt
ttgagcctgttcaacacctcctccaccgcgtcggccaaccggccgccgaacccgcacccc
agcggagcccggccgccggagctgcccaaggagctgatcccccagcacgtggcgatcgtg
atggacggcaacggccgctgggccaaggagcgcggactggcccgcaccgagggccaccgg
gccggtgagagctcgctgttcgacgtcgtcgagggcgcgctggagctgggtgtgggccac
ctctccgcctacgccttctccaccgagaactggaagcgctcgcccgacgaggtgcgcttc
ctcatgggcttcaaccgcgaggtcatccgccgaaggcgcgacgagctgcacgccatgggt
gtccgggtccgctgggcggggcggcgcggacggttgtggaagagcgtcatctccgagttg
gaggacgccgaggagatgaccaagcacaacacggcgctgaccctgcagttctgcgtcaac
tacggcggccgcgccgagatcgccgacgccgcggcggcgctcgcccgcaaggccgccgag
ggccgcctcaaccccgaccgcatcaccgaggccatgctggccaagcacctcgacgagccc
gacatccccgacgtcgacctgttcctgcgctcctccggcgagcagcgcacgtccaacttc
ctgctgtggcagtcggcctacgccgagatggtcttcctcgacaccctctggcccgacttc
gaccgccgccacttctggcacgcctgccaggtctacgccagccgcgaccgccgctacggc
ggcgccgtgcccaatcccgtcgagccccgaccgacgaccaccgaggaggcgcgttga

DBGET integrated database retrieval system