KEGG   Streptomonospora sp. M2: EKD16_10145Help
Entry
EKD16_10145       CDS       T05863                                 

Gene name
spk1
Definition
(GenBank) Serine/threonine-protein kinase PK-1
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
strr  Streptomonospora sp. M2
Brite
KEGG Orthology (KO) [BR:strr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:strr01001]
    EKD16_10145 (spk1)
Enzymes [BR:strr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EKD16_10145 (spk1)
Protein kinases [BR:strr01001]
 Serine/threonine kinases: Other
  Bacterial family
   EKD16_10145 (spk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal DUF2604 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: QBI53815
LinkDB All DBs
Position
complement(2283166..2285124)
Genome map
AA seq 652 aa AA seqDB search
MTTADPLVGTTLDHRYHVEARVASGGMATVYVARDLRLDRRLACKVMHASLAQDPAFVRR
FINEAHSVAKLSHPNVVQVYDQGTDQGHVYLAMEYVPGQTLREMLNERGRLAPADALDII
SPVLAALGAAHQAGLVHRDVKPENVLLTEDGRVKVADFGLARAVESAQQGTTKTGAVMGT
AAYLAPEQIERGAADARTDVYAAGIMLYELLTGTQPHTGDTPISIAYQHVNEDVPRPSRV
VAGLPPQIDTLVTRATERDPRYRPGDAGQYLALVLNTKSDASGEYSADASPPGSGGNDTL
VVETGGLAEAAPAEPGGRGRRGRRRLALDYRSYPMMLVAGVLAVVMLAGGWWFLVGRYEP
VPDIVGMPEQDAAAVLGSVPVRMEVGDKRVYSEEDPGRIAEVEPAVGERILPQDTVTVYL
SKGPQTVEMPDLVGQNAQDARAALEDDGFTRIQEEEADSEDQPAGTVIGTDPEPGSDADR
EAPVTLTVSAGFDIPDVVGRQQDQARNMLQEKGLRVSITEQPSEDVPEGEVISQEPGAGG
TVSSGDSVTLTVSSGPEDIEIPDVAGWKVKDAKKRLEDLGFTVKVTRILGGDRVSQYNPQ
GSAPEGTEIELVVSPFAPQGGNGGPGQGGGQGGQGGQGGNGNQGDQGDGGDD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgccgaccctctggtgggcacgacactcgatcaccgctaccacgtcgaggcg
cgggtggccagcggcggtatggccacggtctacgtcgcccgcgacctgcggctggaccgc
cgcctggcctgcaaggtgatgcacgcctcgctggcccaggaccccgctttcgtgcgccgc
ttcatcaacgaggcgcactcggtcgccaagctctcccaccccaacgtggtgcaggtctac
gaccagggcaccgaccaggggcacgtgtacctggccatggagtacgtgcccgggcagaca
ctgcgcgagatgctgaacgagcgggggcgcctggcacccgccgacgcgctcgacatcatc
tccccggtgcttgcggcgctgggcgccgcgcaccaggccgggctggtccatcgcgatgtc
aagccggagaacgtgctgctcaccgaggacggccgcgtcaaggtcgccgacttcggtctg
gcccgggcggtggagtccgcccagcagggcaccaccaagaccggcgcggtcatgggtacc
gccgcctatctggcaccagagcagatcgagcgcggcgccgccgatgcgcgcaccgacgtc
tacgcggccgggatcatgctctacgagctgctgaccgggacgcagccgcacaccggcgac
acccccatctccatcgcctaccagcacgtcaacgaggacgtcccgcggccctcccgggtg
gtcgcgggcctgcctccgcagatcgacacgctggtcacccgcgccaccgagcgcgacccc
cgctaccggcccggcgacgccgggcagtacctcgcgctggtgctgaacaccaagtcggac
gcgagcggggagtacagcgccgacgcgtcccctcccggctccggcggcaacgacaccctc
gtggtcgagaccggcggtctggccgaggcggctccggccgaaccgggcgggcgcggccgc
cgcgggcgccgccggctcgccctggactaccgcagctacccgatgatgctggtcgccggc
gtgctcgcggtggtgatgctggccggcggctggtggttcctggtcggacgctacgagccg
gtacccgacatcgtcggcatgccggaacaggacgccgccgccgtgctgggcagcgtgccc
gtgcgcatggaggtgggcgacaagcgcgtctactccgaggaggatcccggcaggatcgcc
gaggtcgagcccgccgtgggcgagcgcatcctcccgcaggacacggtgacggtgtacctg
tccaaggggccgcagacggtcgagatgcccgacctggtgggccagaacgcccaggacgcc
cgggcggcgctggaggacgacggcttcacccggatccaggaggaggaggccgactccgag
gaccagccggcggggacggtcatcggcaccgatcccgagccgggctccgacgccgaccgg
gaggcgccggtcaccctcaccgtcagcgcgggattcgacatccccgacgtggtgggccgg
caacaggaccaggcgcgcaacatgctgcaggagaaggggctgcgggtctccatcaccgag
cagcccagcgaggacgtgcccgagggcgaggtcatctcccaggagcccggcgccggcggc
acggtcagctccggcgacagcgtcaccctcacggtctcctccggccccgaggacatcgag
atccccgacgtggccgggtggaaggtcaaggacgccaagaagcgcctggaggacctgggc
ttcacggtgaaggtcacccggatcctcggcggggaccgcgtgtcgcagtacaacccgcag
ggttcggcgcccgaaggcaccgagatcgaactcgtggtcagcccgttcgcgccgcagggc
ggcaacggcgggccgggccagggcggcggccaaggaggccagggcggtcaaggcggcaac
ggaaaccagggcgatcagggcgacggcggcgacgactga

DBGET integrated database retrieval system