KEGG   Streptomonospora sp. M2: EKD16_13955Help
Entry
EKD16_13955       CDS       T05863                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EKD16_13955 (gutB)
Enzymes [BR:strr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EKD16_13955 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EKD16_13955 (gutB)
    1.1.1.-  
     EKD16_13955 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: QBI54573
LinkDB All DBs
Position
3167843..3168973
Genome map
AA seq 376 aa AA seqDB search
MDGRTPAAGDTMPALRWHGPRDLRLDTVAVPEPGPGTVLVAVERVGLCGTDLEEYTDGPV
QIPAAAAHPLSDRRAPVVLGHEVVGRVAACPGGELRTGARVVPDVVVGCGRCWWCGRHQP
GLCPTGAVRGLQDDGGLAHYMAADAARAVEVPEHVPADAAGFAEPLSVAVRALRKAGDLS
GACVAVLGAGTIGLLTAAVAAARGAGRVLAVDPVATRRRLAEGFGAAAAPPDGAADLVGD
ASCGRGADVVVECSGTPPAAAQAPLLARRGGTVVLVGTPPPGTGIAVREVVAREQRVLGS
VAHIWDEDTAAAVALLSRGTIDPSPLLSAVVRLEDAVHGGFERLLRDRDALKVLVAPGPA
EAPGGAPVPAAPSPRP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggacggccgcactcccgccgccggggacacgatgcccgccctgcgctggcacgggccc
cgcgacctccgcctggacacggtcgcagtgcccgagccgggaccgggtaccgtcctggtc
gccgtggagcgcgtcggcctgtgcggcaccgacctggaggaatacaccgacggccccgtg
cagatccccgccgccgcggcgcatccgctctcggaccggcgggcgcccgtggtcctggga
cacgaggtcgtgggccgggtggcggcctgtcccggtggggagctgcggacaggcgcccgg
gtggtgcccgacgtggtcgtggggtgcggccgctgctggtggtgcggccgccatcagccg
ggcctgtgcccgacgggcgccgtgcgcggactgcaggacgacggcggcctggcgcactac
atggcggccgacgccgcccgcgccgtggaggtccccgagcacgtgccggccgacgcggcg
ggtttcgccgagccgctgtcggtcgccgtgcgtgcgctgcgcaaggccggagacctctcc
ggggcctgtgtggccgtgctcggcgccggaacgatcgggctgctgaccgccgcggtcgcc
gccgcccgcggcgccggccgggtgctcgccgtcgatccggtcgcgacgcggcgccggctc
gccgaggggttcggggcggccgcggcgccacccgacggtgccgccgacctcgtgggggac
gcctcgtgcggccgcggcgccgatgtcgtggtcgagtgctcgggcacgccgccggcggcg
gcccaggcgcccctgctcgcccggcgcggcggaaccgtcgtcctggtcggcacgccgccg
ccgggcaccggcatcgccgtacgggaggtcgtcgcgcgcgagcagcgcgtcctcggcagc
gtcgcccacatctgggacgaggacacggccgcggcggtggcgctgctgtcccggggcacg
atcgacccctctcccctgctctccgccgtggtgcggctcgaagacgccgttcacggcggg
ttcgaacgcctgctgcgcgaccgggacgcactcaaggtcctcgtcgcgcccggcccggcc
gaggcacccggcggtgccccggtccccgctgcgccaagcccgcgaccgtga

DBGET integrated database retrieval system