KEGG   Streptomonospora sp. M2: EKD16_19710Help
Entry
EKD16_19710       CDS       T05863                                 

Gene name
lmrA
Definition
(GenBank) Multidrug resistance ABC transporter ATP-binding and permease protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
strr  Streptomonospora sp. M2
Pathway
strr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:strr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EKD16_19710 (lmrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:strr02000]
    EKD16_19710 (lmrA)
Transporters [BR:strr02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    EKD16_19710 (lmrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 AAA_22 AAA_33 AAA_29 RsgA_GTPase AAA_30 AAA_25 DUF87 MMR_HSR1 AAA_24 DUF3225
Motif
Other DBs
NCBI-ProteinID: QBI55705
UniProt: A0A4P6Q4X7
LinkDB All DBs
Position
4588152..4590062
Genome map
AA seq 636 aa AA seqDB search
MNSTKASGVPAGEAAAAARDGAADTAAGVPSSAAGDTRPAAPGRDPLWRMIALARPRSTR
FVLGVVLGALATGSGVALLSVAAWLIAKAAEHPPITALSVAVVATRALGISRGVTRYLER
LVTHDAAFRTLADVRVRVYERLARTEPVRRFRSGDLVSRLVSDTDATQDLLVRGLTPPLA
ALLTGGATVLFGTVLLVPGGLLLGTGLVLAGVAVPLVAAALGRRPGRRQADARGELSTAL
VDTLYGAPDLVAYGAMERAVQRVNDADAELTRVARRDAAVLGFGAGAASLITGLTVWGTL
LLGVTAVQGGTLSAISLAVLVLTALAAFETVAPLPAVAARLGAIRAGGERLFGILDTPPS
VAAPARADRPLPEPAESAGTTGADPDGDDGAAGDGDSGLRVRSLRVRYAPDEPWALNGVD
LAVPPGRTVAVVGPSGAGKSTLAAVLLRFRDPDSGTVELHGADITEYAADEVRAAVTGVP
QDPHIFASTVRENLRLAAAPDADDERLWEALERARLADEVRAMPEGLGTEVGSHGMRLSG
GMRQRLALARALLAAPRVLVLDEPTAHLDPDARDAVVADVLAAAEGYSTLLITHDLAGLD
RVDDVYVVAEGEVVQHGTHEELSADEQGWYARALRA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaccaaggcatccggagttcccgcgggcgaggctgccgcggcggcgcgggat
ggcgcggccgacaccgcggcgggtgtgccgtcgtccgccgcgggcgacacccgccccgcc
gcacccggcagagacccgctgtggcggatgatcgccctcgcgcggccgcgcagcacgcgt
ttcgtgctgggcgtcgtgctgggcgcactcgccacgggttcgggggtggcgctgctgagt
gtcgccgcgtggctcatcgcgaaagctgcggagcacccgcccatcacggcgttgagcgtc
gccgtggtcgccacccgggcactggggatctcccgcggcgtcacgcggtacctggagcga
ctggtgacccacgatgcggcgttccgcacgttggccgacgtgcgggtccgggtctacgag
cggctggcgcgcaccgaaccggtgcgccgcttccgttccggcgatctggtgtcgcggctg
gtcagcgacaccgatgccactcaggatctgttggtgcgcgggctgacaccgccgctcgcc
gcgctgctcaccgggggcgcgaccgtgctcttcggcacggtgctgctggtgcccggcggc
ctgctgctggggacggggctggtcctggcgggagtggcggttccgctggtcgcggcggcg
ctggggcggcggccgggccggcgccaggcggacgcccgcggagagctgtcgacggccttg
gtcgacaccctctacggggcaccggatctggtcgcctacggtgcgatggagcgcgccgtg
cagcgggtgaacgacgccgacgccgagctgacacgcgtcgcccggcgcgacgccgccgtg
ctgggcttcggggcgggggcggcctcgctgatcaccggcctgacggtgtgggggacgctg
ctgctcggggtcaccgcggtccagggcggcacgctcagcgcgatctcgctggccgtgctg
gtgctgacggccctggcggcgttcgagaccgtggcgccgctgccggcggtcgcggcccgg
ctgggcgccatccgcgccggcggcgaacgcctcttcggcatcctggacacgcctccctcg
gtcgctgccccggcccgtgcggaccggccgctgcccgagcccgccgagtccgccggaacg
accggcgcagaccccgacggcgacgacggcgcggcgggtgacggggacagcgggctgcgc
gtgcgctcactgcgggtgcgctacgcccccgacgagccctgggccctgaacggggtggac
ctcgccgtaccgccggggcgaaccgtggccgtggtgggtccgagcggcgccgggaagagc
acgctcgccgctgtgctgctgcggttccgcgaccccgactccgggacggtggagctgcac
ggcgccgacatcaccgagtacgcggccgacgaggtccgcgccgcggtcacgggcgtaccg
caggacccgcacatcttcgcgagcacggtgcgcgagaacctccggctcgccgccgccccc
gatgcggacgacgagcggctgtgggaggcgctggagcgggcacggctggcggacgaggtg
cgcgcgatgccggaggggctcggcaccgaggtgggctcgcacggtatgcggctgagcggc
ggcatgcggcagcggctggcgctcgcccgtgcgctgctggccgcaccgcgcgtgctcgtg
ctggacgagcccacggcgcatctggacccggacgcgcgcgacgcggtcgtggcggatgtg
ctggcggcggccgagggatactcgacgctgctgatcacccacgacctggcgggcctggac
cgggtggacgatgtctacgtggtcgccgagggcgaggtcgtccagcacggcacgcacgag
gagctgtcggcggacgagcaggggtggtacgcgcgcgcactgcgcgcatga

DBGET integrated database retrieval system