KEGG   Streptomonospora sp. M2: EKD16_24230Help
Entry
EKD16_24230       CDS       T05863                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00250  Alanine, aspartate and glutamate metabolism
strr00410  beta-Alanine metabolism
strr00640  Propanoate metabolism
strr00650  Butanoate metabolism
strr01100  Metabolic pathways
strr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EKD16_24230 (gabT)
   00650 Butanoate metabolism
    EKD16_24230 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EKD16_24230 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EKD16_24230 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strr01007]
    EKD16_24230 (gabT)
Enzymes [BR:strr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EKD16_24230 (gabT)
Amino acid related enzymes [BR:strr01007]
 Aminotransferase (transaminase)
  Class III
   EKD16_24230 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QBI56591
UniProt: A0A4P6QA57
LinkDB All DBs
Position
5553294..5554559
Genome map
AA seq 421 aa AA seqDB search
MAEQSAALSPLLKQATPVLAARGEGVYIYDEDDRRYLDFTAGIGVTSTGHCHPRVVEAAQ
RQVATLVHGQYTTVMHRPLLRLTERLGSVLPEGIDRLFYVNSGSEAVEAALRLARQATGR
QNAIVFQGGFHGRTMAAASLTTSGTKIRAGIGPLMPGVVVSPFPYAYRLGMSEEEATEHA
LRELDYQLATVSSPKDTAAIFIEPVLGEGGYIPAPPAFLRGLRERADEHGILLVADEVQT
GFGRTGEFWGHDHAGVRPDIVITAKGLASGFPLSAIAAPDSLMEKAWPGSQGGTYGGNAV
SCAAALATLDVIEDEGLVANAARMGERLREGLAGVAADHPVIGDVRGLGLMIGNEFTAPD
GSPDTATATRAHKAAADKGLLLLTCGPHGNVVRMIPPLIVTADQVDEAVTLWSAAMKEAT
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagtcggccgcgctttcccccttgctcaagcaggcgacaccggtgctcgct
gcgcggggcgaaggcgtctacatctacgacgaggacgaccgccgctatctcgacttcacc
gccggcatcggggtcaccagcaccggccactgccacccccgcgtcgtcgaggctgcgcag
cgccaggtggccacgctcgtgcacggccagtacaccacggtcatgcaccggcccctcctc
aggctcactgaacgcctcggcagcgtgctgcccgagggcatcgaccggctcttctacgtc
aactccggcagcgaggccgtggaggcggcgctgcggctcgcgcggcaggcgaccgggcgg
cagaacgcgatcgtcttccagggcggcttccacgggcgcacgatggcggcggcgtcgctg
accacgtcgggcaccaagatccgcgcgggtatcgggccgctgatgcccggcgtggtggtc
tccccgttcccctacgcctaccggctgggcatgagcgaggaggaggccaccgagcacgcg
ctgcgggagctggactaccagctggccacggtcagttcgcccaaggacaccgcggcgatc
ttcatcgagccggtcttgggagagggcgggtacatcccggcgccgccggcgttcctgcgc
ggcctgcgcgagcgcgccgacgagcacggcatcctgctggtggccgacgaggtgcagacc
gggttcgggcgcaccggcgagttctggggtcacgaccacgcgggcgtacggcccgacatc
gtcatcacggccaaggggttggccagcgggttcccgctgtcggcgatcgcggcgcccgac
tccctcatggagaaggcgtggccgggctcccagggcggcacctacggcggcaacgcggtc
tcgtgtgccgcggccctggccaccctggacgtcatcgaggacgaagggctggtcgccaac
gccgcccggatgggcgagcgcctccgggagggcctggcgggcgtggcggccgaccacccg
gtgatcggcgacgtgcgcggcctgggcctgatgatcggcaacgagttcaccgcacccgac
ggctcccccgacaccgccaccgccacccgggcgcacaaggcggccgccgacaagggtctc
ctcctgctcacctgcggcccgcacggcaacgtcgtccggatgatccccccgctcatcgtc
accgccgaccaggtcgacgaggcggtcaccctgtggtccgcagccatgaaggaggccacg
gcctga

DBGET integrated database retrieval system