KEGG   Streptococcus salivarius NCTC 8618: SSAL8618_00515Help
Entry
SSAL8618_00515    CDS       T03511                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
strs  Streptococcus salivarius NCTC 8618
Brite
KEGG Orthology (KO) [BR:strs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SSAL8618_00515
Enzymes [BR:strs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SSAL8618_00515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 NAD_binding_8 Lycopene_cycl Glutaredoxin Thioredoxin_9 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AIY20298
UniProt: A0A3S4LJE8
LinkDB All DBs
Position
complement(84032..85564)
Genome map
AA seq 510 aa AA seqDB search
MVLDKEIKTQLAQYLNLLESDIVLQTDLGDDDNSRKVKEFLDEIAAMSDRISLESTHLKR
QPSFGIAQKGQKSRVIFSGLPMGHEFTSFILALLQVSGRPPKVDEDTIERIKKIDKPIDL
ETYVSLTCHNCPDVVQAFNIMAVLNPNITHTMIEGGMYQDEVKAKGIMSVPTVYKDQEEF
TSGRATIEQLVEKLDGPLDADAFADKGVYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVIETVGIENMIGTLYTEGPKLMAQVEEHTKSYDVDIIKSQLATGIEKKELIEVTLA
NGAVLKSKTAILALGAKWRNINVPGEEEFRNKGVTYCPHCDGPLFEGKNVAVIGGGNSGL
EAALDLAGITKHVTVLEFLPELKADQVLQERAAKTDNLTILKNVATKEIVGQDHVTGLNY
VERDTNEEKHLDLEGVFVQIGLVPSTAWLKDSGIELNERQEIIVDKFGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtcttagataaagaaatcaagacgcaattagcacaatatttaaatttactagaatct
gatattgtattacaaacagacttaggggatgacgataattctcgaaaagtaaaagaattt
ctagacgagattgccgctatgtctgaccgcattagtcttgaatcaacacatttaaaacgt
caacctagttttggtattgcacaaaaagggcaaaaaagtcgtgttattttctcaggctta
ccaatgggccacgaattcacatctttcattttagctctcttgcaagtttctggtcgtcca
cctaaagttgatgaggacactatcgaacgtatcaagaagattgataaacccatcgattta
gagacttatgtttcattaacttgtcacaattgtccggacgttgttcaagcttttaatata
atggctgttttgaacccaaatatcactcacaccatgattgaaggtggtatgtatcaggat
gaggtcaaagccaaaggtatcatgtctgttcctacggtttacaaagaccaagaagaattt
acatctggtcgtgcaaccattgaacagcttgtagaaaaattggacggaccacttgatgct
gatgctttcgctgataaaggtgtctatgatgttttggttattggtggtggtcctgctgga
aacagtgctgccatctatgctgcccgtaaaggtttaaaaactggtcttttagcagaaacc
tttggtggacaagttatcgagacagtcggcattgagaatatgattggtacgctatataca
gaaggtcctaagttaatggcccaagttgaagagcatacgaaatcttatgatgttgatatc
atcaaaagtcaattagctactggcatcgaaaagaaagaacttattgaagtgacattggct
aacggtgccgttttaaaatccaaaactgctatcctagctctcggagccaaatggcgtaat
atcaacgttcctggcgaggaagaattccgcaataaaggggttacttactgcccacactgt
gatggaccactatttgaaggaaagaatgttgcagttatcggtggtggtaactcaggtttg
gaagcggctttagatttagcaggcattactaaacatgttacggtcttagagttcttacct
gaattaaaggcagatcaagtcttacaagaacgagctgctaaaactgataatctcaccatt
cttaagaacgttgcaaccaaagaaattgttggtcaagatcatgtaactggtttgaattac
gttgagcgtgatacaaacgaagaaaaacatcttgatcttgaaggtgtctttgttcaaatt
ggtcttgtaccaagtactgcttggctcaaagatagtggtattgaactcaatgagcgccaa
gaaattatcgttgataaatttggttcaacaaatatccctggtatttttgctgcaggtgac
tgtacagatagcgcctacaagcaaatcattatctccatgggttctggtgctacagctgct
attggagcctttgattacttgattagacaataa

DBGET integrated database retrieval system