KEGG   Streptococcus salivarius NCTC 8618: SSAL8618_05320Help
Entry
SSAL8618_05320    CDS       T03511                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
strs  Streptococcus salivarius NCTC 8618
Pathway
strs00010  Glycolysis / Gluconeogenesis
strs00020  Citrate cycle (TCA cycle)
strs00620  Pyruvate metabolism
strs01100  Metabolic pathways
strs01110  Biosynthesis of secondary metabolites
strs01120  Microbial metabolism in diverse environments
strs01130  Biosynthesis of antibiotics
strs01200  Carbon metabolism
Module
strs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:strs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSAL8618_05320
   00020 Citrate cycle (TCA cycle)
    SSAL8618_05320
   00620 Pyruvate metabolism
    SSAL8618_05320
Enzymes [BR:strs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSAL8618_05320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIY21163
UniProt: A0A0A1DX70
LinkDB All DBs
Position
1092120..1093508
Genome map
AA seq 462 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAEGEVVADNAASAPAVEAAPKVEEVAAVETPVVATQTQAPIVH
EGGKVRATPKARKVARELGIDLAQVPGTGAKGRVHADDVENFKGAQPKATPLARKIAADL
GIDLASVSGTGFGGKITKEDILAISTPAQVKEAAAAPVVEAKPEKVLPEGVEVIPMSAMR
KAISKGMTHSYLTAPTFTLNYDVDMTNLMALRKQVLDPIMNKTGMKVTFTDLIGLAVVRT
LMKEEHRYLNASLIDDAQNIELHKFVNLGIAVGLDDGLIVPVVHGADKMSLSEFVVASKD
VIKKAQAGKLKAAEMSGSTFSITNLGMFGTKSFNPIINQPNSAILGVSATIQTPVVVDGE
VVVRPIMGLCLTIDHRIVDGMNGAKFMVDLKHLIENPMELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagattattatgcctaagcttggtgttgatatgcaggaaggcgaaatcatc
gagtggaagaaacaagagggtgatgtggttaatgagggagatattcttcttgaaatcatg
tcagataaaacgaacatggaacttgaagcagaagattctggtgttcttttgaagattact
cgtcaggctggtgaaactgtaccagttactgaagttatcggttatattggagcagaaggt
gaagttgtggctgataatgctgcgagtgcacctgcagttgaagctgctccaaaagttgaa
gaagttgccgctgtagaaacacctgtagtagcaacgcaaacacaagcacctatcgttcac
gaaggcggcaaagtacgtgcaacacctaaggctcgaaaggtggcgcgtgagttggggatt
gacctcgctcaagttccaggaactggagcaaaaggtcgtgttcatgcagatgacgttgag
aactttaaaggtgctcaacctaaggcgactccattggcacgtaagatcgcagcggacctt
ggtattgacttagctagcgtatctggaacaggctttggtggtaagattactaaggaagat
atccttgcaatcagtactccagcgcaagttaaagaagcggctgctgcacctgtggttgaa
gctaaacctgaaaaagtcttgccagaaggcgtggaagttatcccaatgtctgctatgcgt
aaggcaatttctaagggaatgacgcactcatacttgactgcaccaacctttactcttaac
tatgatgttgatatgactaaccttatggctcttcgtaagcaagtccttgacccaatcatg
aataagactggtatgaaggtaaccttcacggatttgattggtttggcagttgtgcgtact
cttatgaaagaggaacaccgttacctcaatgcgtcattgattgatgatgcacaaaatatc
gaattacataaatttgttaatctcggtattgccgttggtctcgatgatggcttgattgta
cctgtcgttcacggtgcagataagatgagtttgtctgagttcgttgtggcttctaaggat
gtcatcaagaaggctcaagctggtaaattgaaggctgcagaaatgtcaggttcaactttc
tctattactaacttgggaatgtttggaactaagtcatttaacccaatcatcaaccaacca
aactcagctatccttggtgtttcagcaactattcaaactccagttgttgttgatggagaa
gttgtcgtacgaccaatcatgggtctatgcttgacaattgaccaccgtatcgtagatggt
atgaatggtgccaaattcatggttgatttgaaacatttgattgaaaatcctatggaattg
ttgatttaa

DBGET integrated database retrieval system