KEGG   Streptomyces sp. SAT1: A8713_06765Help
Entry
A8713_06765       CDS       T04706                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00051  Fructose and mannose metabolism
strt01100  Metabolic pathways
strt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A8713_06765
Enzymes [BR:strt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A8713_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ANH90903
UniProt: A0A1A9ITK2
LinkDB All DBs
Position
complement(1547738..1548526)
Genome map
AA seq 262 aa AA seqDB search
MAERRRETGHTGRASGTRGTQEHQGARETHETRATGEAPPDEDEVARAWRDLVDTARRTV
ADGLVVGTSGNVSVRTGDTVLVTPSGVPYDRLTPDDVTGVALDGRQVLGTLVPTSELPMH
LAVYRTTDARAVVHTHAVHATAVSTLVSELPLIHYMAGALGGPVRVAPYAAYGTEELAAH
VLAALDGRSGCLLRNHGTLTHGATLDQAYDRTAQLEWMCRLWLTASSVPGLTPSLLSPEQ
LAQASERLRGYGQRGGARGTGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgacggcgggagaccgggcacaccggacgcgcgagcggcacgcgcgggact
caggagcaccagggggcacgggagacacacgagacccgggcgacgggggaggcgccgccg
gacgaggacgaggtggcccgcgcctggcgggacctggtggacacggcccgccgcaccgtc
gccgacggcctggtcgtcgggacctcgggcaatgtgtcggtacggacgggggacaccgtc
ctcgtcaccccgtcgggcgtcccctacgaccggctcaccccggacgatgtgacgggcgtc
gcactcgacggccgacaggtgctgggcaccctggtcccgaccagcgaactccccatgcac
ctggccgtctaccgcaccacggacgcgcgcgccgtcgtgcacacccacgccgtgcacgcc
acggccgtctcgacgctggtgtccgagctgccgctgatccactacatggcgggcgcgctc
ggcggcccggtgcgcgtcgccccgtacgcggcctacggcaccgaggaactggccgcgcac
gtgctggccgcgctcgacggccgctccggctgcctgctgcgcaaccacggcaccctcacc
cacggcgccaccctcgaccaggcgtacgaccgcaccgcccagctggagtggatgtgccgc
ctgtggctgaccgcctcctcggtaccgggcctgaccccgtccctgctctcaccggagcaa
ctggcccaggcgtcggagcggctgcgcggctacggccagcgcggcggggcacggggcacg
ggccggtga

DBGET integrated database retrieval system