KEGG   Streptomyces sp. SAT1: A8713_12710Help
Entry
A8713_12710       CDS       T04706                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00620  Pyruvate metabolism
strt00680  Methane metabolism
strt01100  Metabolic pathways
strt01120  Microbial metabolism in diverse environments
strt01200  Carbon metabolism
Module
strt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:strt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8713_12710
  Energy metabolism
   00680 Methane metabolism
    A8713_12710
Enzymes [BR:strt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A8713_12710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF615
Motif
Other DBs
NCBI-ProteinID: ANH91916
UniProt: A0A1A9IWS1
LinkDB All DBs
Position
complement(2945919..2948660)
Genome map
AA seq 913 aa AA seqDB search
MSSADDQTTTSSELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELLR
GTELETAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLARTADQLKDADPEHLR
QTVRHLNVRPVFTAHPTEAARRSVLNKLRRIGALLETPVVESDRRRLDTRLAENIDLVWQ
TDELRVVRPEPTDEARNAIYYLDELHAGAVGDVLEDLTAELERVGVRLPDETRPLSFGTW
IGGDRDGNPNVTPAVTWDVLILQHEHGINDALDTIDELRAFLSNSIRYSGATEELLRSLD
TDLENLPEISPRYKRLNAEEPYRLKATCIRQKLVNTKERLAKGTPHQAGHDYLGTAELLA
DLRLIQDSLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPREYRTKLLAKELRSRRPLAPTPAPVDEAGAKTLGVFETVKRALDVFGPEV
VESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGIVPLLETTDELKAADTILEDML
SDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAASL
QASALHTAPRQSGEALARWDAAMDIVSDAAHAAYRRLVEDPDLPAYFFASTPVDQLADLH
IGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLRALREAGVRQEGETVL
EEMHERWHFFRNFISNVEMTLAKTDLRIAGHYVDTLVPDHLKHVFEAIQAEHELTVAEVL
RITGESELLDAEPVLKQTFAIRDAYLDPISYLQVALLKRQRDAVAAEQEADPLLSRALLL
TVNGVAAGLRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagacgacgaccagcagcgagctgcgcgccgacatccgccga
ctgggtgacctcctgggggagaccctggtgaggcaggaaggtcccgaactcctggacctg
gtggagaaggtgcgccgcctcacccgggaggacggcgaagcagcggccgaactgctgcgc
ggcaccgaactggagaccgcggccaagctggtccgcgccttctccacctacttccacctc
gccaacgtcaccgaacaggtccaccgcggccgcgagctgcgcgcccgccgcgccgccgag
ggcggcctgctggcccgcaccgcagaccagctcaaggacgccgaccccgagcacctgcgc
cagacggtccggcacctcaacgtccgcccggtgttcaccgcgcaccccaccgaggcggcc
cgccgctccgtcctgaacaagctccgccgcatcggcgccctcctggagaccccggtcgtc
gagtccgaccgccgccgcctggacacccgcctcgccgagaacatcgacctcgtctggcag
accgacgaactgcgcgtcgtacgccccgaacccaccgacgaggcccgcaacgccatctac
tacctggacgagctgcacgccggcgccgtcggcgacgtcctggaggacctgaccgccgaa
ctggagcgcgtcggcgtcagactccccgacgagacccgccccctcagcttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtcaccccggccgtcacctgggacgtgctg
atcctccagcacgagcacggcatcaacgacgccctcgacaccatcgacgagctgcgcgcc
ttcctgtccaactccatccgctacagcggcgccaccgaggaactcctgcgctccctcgac
acggacctggagaacctgcccgagatcagcccccgctacaagcggctcaacgccgaggag
ccctaccggctcaaggccacctgcatccggcagaagctcgtcaacaccaaggagcgcctg
gccaagggcaccccgcaccaggccggccacgactacctgggcaccgccgagctcctcgcc
gacctgcggctgatccaggactcgctgcgcgagcaccgcggcggcctgttcgccgacggc
cgcctggcccgcaccatccgcaccctggccgccttcggcctccagctcgccaccatggac
gtgcgcgagcacgccgacgcccaccaccacgcgctcggccagctcttcgaccggctcggc
gaggagtcctggcgctacgccgacatgccccgcgagtaccgcaccaagctgctcgccaag
gaactccgctcgcgccggccgctcgccccgacgcccgcccccgtcgacgaggccggcgcg
aagacgctcggcgtgttcgagacggtcaagcgggccctggacgtcttcgggcccgaggtc
gtcgagtcgtacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgccgtc
ctcgcccgcgaggccggactgctcgacctgcacgcaggctgggccaagatcggcatcgtg
ccgctgctggagaccaccgacgagctgaaggccgccgacaccatcctggaggacatgctc
tccgacccgtcctaccggcgcctggtcgcgctgcgcggggacgtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcgccgactgcgcgacgtcgcccaccgctacggcgtgcggctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgccatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctccgac
aagtacctcatcccctccctggcccgggagaacctggaactgacggtcgccgccagcctc
caggcgtccgccctgcacaccgcgccccgccagtccggcgaggcgctggcccgctgggac
gcggccatggacatcgtctccgacgccgcccacgccgcctaccgcaggctggtggaggac
cccgacctgcccgcgtacttcttcgcctccaccccggtcgaccagctcgccgacctgcac
atcggctcccggccctcgcgccgccccgactccggcgccggactcgacgggctgcgcgcc
atcccgtgggtgttcggctggacccagtcgcggcagatcgtccccggctggttcggggtc
ggctccggcctcagggcgctgcgcgaggcgggcgtacggcaggagggcgagaccgtgctg
gaggagatgcacgagcgctggcacttcttccgcaacttcatctccaacgtcgagatgacg
ctcgccaagaccgacctgcgcatcgccgggcactacgtcgacacgctcgtccccgaccac
ctcaagcacgtcttcgaggccatccaggcggagcacgagctgaccgtcgccgaggtgctg
cgcatcaccggcgagagcgaactcctggacgccgagccggtcctgaagcagaccttcgcc
atccgcgacgcctatctggacccgatctcctacctccaggtcgccctgctcaagcggcag
cgcgacgcggtggcggcggagcaggaggccgacccgctgctctcgcgggcgctgctgctg
accgtcaacggagtcgcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system