KEGG   Streptomyces sp. SAT1: A8713_16450
Entry
A8713_16450       CDS       T04706                                 

Definition
(GenBank) alkaline phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00521  Streptomycin biosynthesis
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A8713_16450
Enzymes [BR:strt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     A8713_16450
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Other DBs
NCBI-ProteinID: ANH92553
UniProt: A0A1A9IY82
LinkDB
Position
complement(3799184..3800554)
AA seq 456 aa
MHRPTRRQLTIATALAVTTAAALTATTVAGASDSKQHAQHAIQGGKAKNVILLIGDGMGD
SEITLARDYTVGADGRLNMDKFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGHKTVN
GRISKTPGSDKAVPTILELAQKNGYATGSVTTAELTDATPAVLASHVTDRSCQGPADMAK
CPKDTVKAGGPGSIAEQSVNHKVDVLFGGGKQRFDQKITEGRYKGLTVTQQAQKLGYQVV
TDKASLKAARPGKPVLGLFAKENVPVEWTGKGAAVGGTAPQRCVTSNSSRPASTPSLADS
ATKAIQLLEAKQKHGHGRSDKGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVARD
YAAKHPDTLVVTTADHGHSSQIVPVDAMPPGLSSTLVTDEGQQLKVNYSTNTPGQSQEHT
GTEVRIAAQGPQAFRVLGVTNQTDLFTTVREALRLR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcacagacccacccgtcgtcagctcacgatcgccaccgcgctggccgtcaccaccgcg
gccgccctgaccgccaccacggtggccggcgcctcggacagcaagcagcacgcccagcac
gccatccagggcggcaaggcgaagaacgtcatcctgctgatcggcgacggcatgggtgac
tccgagatcaccctcgcccgggactacacggtgggtgccgacgggcgcctgaacatggac
aagttcccgctgaccggcgcgtacacgacgtacgcggtgcacgccgacggcacgccggac
tacgtcaccgactccgccgccagcggcaccggctgggccaccgggcacaagacggtcaac
ggccgcatctccaagacgccgggctcggacaaggccgtcccgaccatcctggagctggcg
cagaagaacggctacgcgaccggcagcgtcaccaccgccgagctcaccgacgccaccccg
gcggtgctcgcctcgcacgtcaccgaccgctcctgccagggcccggccgacatggccaag
tgccccaaggacacggtcaaggccggcggccccggctccatcgccgagcagtccgtcaac
cacaaggtcgacgtgctcttcggcggcggcaagcagcgcttcgaccagaagatcaccgag
ggccggtacaagggcctgaccgtgacccagcaggcgcagaagctcggctaccaggtcgtc
accgacaaggcgtccctcaaggccgcccggccgggcaagccggtcctcggcctgttcgcc
aaggagaacgtgccggtggagtggaccggcaagggcgccgcggtcggcggtacggccccg
cagcggtgcgtgacctccaacagctcgcgtcccgcgagcaccccgagcctggccgactcc
gccaccaaggcgatccagctgctggaggccaagcagaagcacggccacggccgctccgac
aagggcttcttcctccagatcgagggcgcctcgatcgacaagcaggaccacgccgccgac
ccgtgcggccagatcggtgagaccgcggccttcgaccgcgcggtcaaggtggcccgcgac
tacgcggccaagcaccccgacaccctcgtggtgaccaccgccgaccacggtcacagcagc
cagatcgtcccggtggacgccatgccgcccggcctgtcctccaccctggtcaccgacgag
ggccagcagctgaaggtcaactactcgaccaacaccccgggccagtcgcaggagcacacc
ggcaccgaggtccgtatcgccgcgcagggcccgcaggccttccgcgtcctcggcgtcacc
aaccagacggacctgttcaccacggtccgcgaggcgctgcgcctgcgctga

DBGET integrated database retrieval system