KEGG   Streptomyces sp. SAT1: A8713_17315Help
Entry
A8713_17315       CDS       T04706                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00010  Glycolysis / Gluconeogenesis
strt00053  Ascorbate and aldarate metabolism
strt00071  Fatty acid degradation
strt00280  Valine, leucine and isoleucine degradation
strt00310  Lysine degradation
strt00330  Arginine and proline metabolism
strt00340  Histidine metabolism
strt00380  Tryptophan metabolism
strt00410  beta-Alanine metabolism
strt00561  Glycerolipid metabolism
strt00620  Pyruvate metabolism
strt00625  Chloroalkane and chloroalkene degradation
strt00903  Limonene and pinene degradation
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01120  Microbial metabolism in diverse environments
strt01130  Biosynthesis of antibiotics
Module
strt_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8713_17315
   00053 Ascorbate and aldarate metabolism
    A8713_17315
   00620 Pyruvate metabolism
    A8713_17315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A8713_17315
   00561 Glycerolipid metabolism
    A8713_17315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A8713_17315
   00310 Lysine degradation
    A8713_17315
   00330 Arginine and proline metabolism
    A8713_17315
   00340 Histidine metabolism
    A8713_17315
   00380 Tryptophan metabolism
    A8713_17315
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8713_17315
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A8713_17315
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A8713_17315
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A8713_17315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ANH92695
UniProt: A0A1A9IZE7
LinkDB All DBs
Position
4020942..4022402
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLARQYIDGEWRQGSGSWDIIDFNPYDDEKLASITIATVDEVDAAYRAAARAQK
QWAATNPYARRLVFEKALRLVEEREREITEVIIAELGGTHLKAAFELHLVKEFLRESVHL
ALAPEGRILPSPSDGKENRVYRVPVGVVGVISPFNFPFLLSVKSVAPALALGNAVVLKPH
QNTPIAGGTLVAKIFEDAGLPGGLLNVVVTDIAEIGDAFIEHPVPKVISFTGSDKVGRHV
ATVCAANFKRSVLELGGNSAIVVLDDADLDYAVDAAVFSRYVHQGQVCMAANRVLVDRSV
AEEFTGKFVAKVKSLKVGDPRDPGTVIGPVINSAQANAVSGTVEQAIAEGATALVHGTTR
DNLVAPSVLTGVPADSALLQQEVFGPVAFLIPFDGEEEAVRIVNDTPYGLSGAVHTADIE
RGVAFAKRIDTGMFHVNDGTVHDEPLVPFGGEKHSGIGRLNGETTVDAFTTVKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgacctggcacggcagtacatcgacggcgagtggcgccagggc
agtggctcctgggacatcatcgacttcaatccgtacgacgacgagaagctggcctcgatc
acgatagccaccgtcgacgaggtcgacgcggcctaccgcgcggcggcccgtgcccagaag
cagtgggccgcgaccaacccctacgcgcgccggctggtcttcgagaaggcgctgcgcctg
gtcgaggagcgcgagcgggagatcaccgaggtgatcatcgccgagctgggcggtacgcac
ctcaaggccgccttcgagctgcacctcgtcaaggagttcctccgcgagtcggtccatctg
gcgctggcccccgagggcaggatcctgccgtcgccgtccgacggcaaggagaaccgcgtc
taccgcgtcccggtcggcgtcgtcggcgtcatcagccccttcaacttcccgttcctgctg
tcggtcaagtcggtcgccccggcgctcgcgctcggcaacgccgtggtgctcaagccgcac
cagaacacgcccatcgccggcggcaccctggtcgcgaagatcttcgaggacgcgggtctg
cccggcggtctgctcaacgtcgtcgtcacggacatcgccgagatcggtgacgcgttcatc
gagcacccggtcccgaaggtgatctccttcaccggctccgacaaggtcggccggcacgtg
gccaccgtgtgcgccgcgaacttcaagcgctccgtgctcgaactgggcggcaacagcgcg
atcgtggtcctggacgacgccgacctcgactacgcggtcgacgcggccgtcttcagccgc
tacgtccaccagggccaggtctgcatggcggcgaaccgggtcctcgtggaccgttcggtc
gccgaggagttcaccgggaagttcgtcgccaaggtgaagtcgctgaaggtcggcgacccg
cgcgacccgggaacggtcatcggcccggtgatcaactcggcgcaggcgaacgcggtgtcc
ggcaccgtggagcaggccatcgccgagggcgcgacggcgctggtccacggcaccacccgg
gacaacctggtcgccccctccgtcctgaccggggtgcccgccgactccgcgctgctccag
caggaggtcttcgggccggtcgccttcctcatccccttcgacggcgaggaggaggcggtc
cggatcgtcaacgacaccccgtacggcctcagcggcgccgtgcacacggcggacatcgag
cgcggtgtggccttcgccaagcggatcgacaccggcatgttccatgtgaacgacggcacc
gtccacgacgagccgctggtccccttcggcggcgagaagcactccggcatcggccggctc
aacggcgagacgaccgtggacgccttcaccacggtgaagtggatctcggtccagcacggc
cgcagcggcttcccgttctga

DBGET integrated database retrieval system