KEGG   Streptomyces sp. SAT1: A8713_19410Help
Entry
A8713_19410       CDS       T04706                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
strt  Streptomyces sp. SAT1
Brite
KEGG Orthology (KO) [BR:strt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A8713_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ANH93062
UniProt: A0A1A9J2H7
LinkDB All DBs
Position
4475093..4476052
Genome map
AA seq 319 aa AA seqDB search
MDWLKNLPVIGPWLTRLMQTHAWRSYERLDRVKWTRLAAAMTFVSFIALFPLLTLAAAIG
AATLSTRQQHTMESKIAQQFPGLGDQLHITSLAQNAGTVGIIAGAALLFTGMGWVGQMRD
CLRAVWELPDPEKNPVVSKVQDAGILVGFGGAVLITLAVSTVASAAVGWTSRAVGLGEDG
AGSVVLRVIAFAVAVLADFLVLLYVLTLLPGVEPPRHRLVVAALLGAVGFELLKLLLSGY
IQGVAAKSMYGAFGVPVALLLWINFTAKLVLYCSAWTATGSAAEADGDAAGPGTGGADDG
GGDATEGPGGRLRGADGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggactggctgaagaacctccccgtgatcggcccgtggctgacacgtctgatgcagacg
cacgcgtggcggtcgtacgaacgtctggaccgggtcaaatggacccggctcgccgccgcc
atgacgttcgtcagcttcatcgcgctgttcccgctgctgaccctggccgccgcgatcggc
gccgccaccctcagcacccggcagcagcacaccatggagagcaagatcgcccagcagttc
ccgggcctgggcgaccagctgcacatcacctcgctggcgcagaacgcgggcaccgtcggg
atcatcgccggtgccgccctgctcttcaccggcatgggctgggtcggccagatgcgcgac
tgcctgcgcgccgtgtgggagctgccggacccggagaagaacccggtggtgagcaaggtc
caggacgcggggatcctggtgggcttcggcggcgcggtgctgatcacgctcgccgtctcc
accgtcgcctcggccgccgtcggctggacctcgcgcgcggtgggcctgggcgaggacggc
gcgggcagcgtggtcctgcgggtcatcgcgttcgccgtcgcggtgctcgccgacttcctg
gtgctcctgtacgtgctgacgctgctgcccggcgtcgagccgccgcgccaccgcctggtc
gtcgccgcgctgctcggcgcggtcggcttcgagctgctgaagctgctgctcagcggctat
atccaaggggtggcggcgaagagcatgtacggcgcgttcggggtcccggtcgcgctgctg
ctgtggatcaacttcacggccaagctggtgctgtactgctccgcctggaccgcgaccggc
agcgcggcggaggcggacggggacgccgccggtccggggaccggcggcgcggacgacggc
ggcggcgacgcgaccgaagggcccggcgggcggctcaggggcgcggatggcgccgcatga

DBGET integrated database retrieval system