KEGG   Streptomyces sp. SAT1: A8713_21345Help
Entry
A8713_21345       CDS       T04706                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00020  Citrate cycle (TCA cycle)
strt00310  Lysine degradation
strt00380  Tryptophan metabolism
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01120  Microbial metabolism in diverse environments
strt01130  Biosynthesis of antibiotics
strt01200  Carbon metabolism
Module
strt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8713_21345 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    A8713_21345 (kgd)
   00380 Tryptophan metabolism
    A8713_21345 (kgd)
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A8713_21345 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ANH93390
UniProt: A0A1A9J0P4
LinkDB All DBs
Position
complement(4913129..4916959)
Genome map
AA seq 1276 aa AA seqDB search
MSPQSPSNSSISTETDQAGKNPAAAFGANEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GAAAAASTAPAGTAAAGAAGTTTAPQAAPAAPAKPAAQAPAAPAAAQPAAPAPAQPAPAP
APAKPAAQAPAPAKAAPAAAKPAPAKAEPAAEAPAGPEFVTLRGPSAAVAKNMNASLELP
TATSVRAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNNSFAEKD
GKPTLVKPDHINLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVRRARDGKL
TMDDFTGVTVSLTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGIS
KVMTLTSTYDHRVIQGAASGEFLRVVANLLLGENGFYDEIFEALRIPYEPVRWLKDIDAS
HDDDVTKAARVFELIHSYRVRGHVMADTDPLEYQQRKHPDLDITEHGLTLWDLEREFAVG
GFAGKSMMKLRDILGVLRDSYCRTVGIEFMHIQDPKQRKWIQDRVERPHSKPEREEQLRI
LRRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVLDSAAESRLDEVVIGMAHRGR
LNVLANIVGKSYAQIFREFEGNLDPKSMHGSGDVKYHLGAGGTFTGLDGEQIKVSLAANP
SHLETVDPVIEGISRAKQDIINKGGTDFTVLPVAIHGDAAFAGQGVVAETLNMSQLRGYR
TGGTVHIVINNQVGFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEF
RQAFNKDVVIDLICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLE
EAEQALQDYQGQLEKVFTEVREATSQPAVPQSPDPQAGFPVRVSTAISAEVVKRIAESQV
NIPDHFTVHPRLLPQLQRRAAMVEDGTIDWGMGETLAIGSLLLEGVPVRLSGQDSRRGTF
GQRHAVLIDRETGEDYTPLLYLADEQARYNVYDSLLSEYAVMGFEYGYSLTRPDALVMWE
AQFGDFANGAQSVIDEYISAAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERYLQLCAQ
NNMTVAMPTLPSNYFHLLRWQVHNPHHKPLVVFTPKSMLRLKAAASKTEEFTTGEFRPVI
GDDSVDPSAVKKVVFCAGKVYYDLDAERKKRGATDTAIIRIERLYPLPGAELQAEIKKYP
NAEKYLWTQEEPANQGAWPFIALNLIDHLDLAVGADVPHSERLRRISRPHSSSPAVGSAK
RHQAEQEQLVREVFEA
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctccaccgagaccgaccaagccgggaag
aaccccgcggccgcgttcggtgccaacgagtggctcgtcgacgagatctatcagcagtac
ctccaggacccgaactcggtagaccgtgcctggtgggacttcttcgccgattacaagccg
ggagccgccgccgctgcctccacggctccggcgggtaccgcggccgcgggggccgcgggc
accaccacggctccccaggcggcgcccgccgccccggcgaagcccgccgcgcaggccccg
gccgcacccgccgccgcgcagcccgccgctccggctccggcgcagcccgccccggccccc
gccccggcgaagcccgccgcgcaggccccggcccccgcgaaggccgccccggccgccgcg
aagccggcgcccgccaaggcggagcccgccgccgaggcaccggccggtcccgagttcgtg
acgctgcgcggcccgtccgccgcggtcgccaagaacatgaacgcctccctggagctgccc
acggccacgtccgtgcgcgccgtcccggtgaagctgctgttcgacaaccgcatcgtcatc
aacaaccacctcaagcgggcccgcggcgggaagatctccttcacgcacctcatcggctac
gcgatggtccaggccatcaaggccatgccctcgatgaacaactcgttcgccgagaaggac
ggcaagccgaccctggtcaagccggaccacatcaacctcggtctcgccatcgacctggtc
aagcccaacggcgaccgccagctcgtcgtcgcggcgatcaagaaggccgagacgctgaac
ttcttcgagttctggcaggcctacgaggacatcgtccgccgcgcccgcgacggcaagctg
acgatggacgacttcaccggcgtcaccgtctccctcaccaaccccggcggcctcggcacg
gtccactccgtgccgcgtctgatgcccggccagtcggtgatcatgggcgtcggctccatg
gactacccggcggagttccagggcaccagccaggacaccctgaacaagctcggcatctcc
aaggtcatgacgctcacgtcgacctacgaccaccgggtgatccagggcgccgcctccggc
gagttcctgcgtgtcgtcgccaacctgctgctcggcgagaacggcttctacgacgagatc
ttcgaggcgctgcgcatcccctacgagccggtccgctggctcaaggacatcgacgccagc
cacgacgacgacgtcaccaaggccgcccgcgtcttcgagctgatccactcctaccgggtc
cgcggccacgtcatggccgacaccgacccgctggagtaccagcagcgcaagcaccccgac
ctggacatcaccgagcacgggctcaccctgtgggacctggagcgcgagttcgccgtcggc
ggcttcgccggcaagtcgatgatgaagctgcgcgacatcctcggcgtgctgcgcgactcg
tactgccgcacggtcggcatcgagttcatgcacatccaggaccccaagcagcgcaagtgg
atccaggaccgcgtggagcgcccgcactccaagccggagcgcgaggagcagctgcgcatc
ctgcgccggctgaacgccgctgaggccttcgagaccttcctgcagacgaagtacgtcggc
cagaagcgcttctccctggagggcggcgagtccgtcatcccgctgctcgacgcggtcctc
gactcggccgccgagtcgcgcctggacgaggtcgtcatcggcatggcccaccgcggccgg
ctgaacgtgctcgccaacatcgtcggcaagtcgtacgcgcagatcttccgcgagttcgag
ggcaacctcgacccgaagtcgatgcacggctccggcgacgtgaagtaccacctgggcgcc
gggggcaccttcacgggcctggacggcgagcagatcaaggtctcgctggccgcgaacccc
tcccacctggagacggtcgacccggtcatcgagggcatctcccgcgccaagcaggacatc
atcaacaagggcggcacggacttcaccgtcctgccggtggcgatccacggcgacgcggcc
ttcgcgggccagggcgtggtggccgagaccctgaacatgtcgcagctgcgcggctaccgc
accggcggcacggtccacatcgtcatcaacaaccaggtcggcttcaccgcggcgcccgag
tcctcgcgctcctcgatgtacgccaccgacgtggcccgcatgatcgaggccccgatcttc
cacgtcaacggcgacgaccccgaggccgtcgtgcgcgtggcgcggctcgccttcgagttc
cgccaggcgttcaacaaggacgtggtgatcgacctcatctgctaccgccgccgcggtcac
aacgagtcggacaacccggccttcacccagccgctgatgtacgacctgatcgacaagaag
cgctccgtgcgcaagctctacaccgagtccctgatcggtcgcggcgacatcaccctggaa
gaggccgaacaggcgctccaggactaccaggggcagctggagaaggtcttcaccgaggtc
cgcgaggccacctcgcagccggccgtcccgcagtccccggacccgcaggccggcttcccg
gtgcgggtgagcaccgcgatctccgccgaggtcgtcaagcggatcgccgagtcccaggtc
aacatccccgaccacttcaccgtccacccgcgcctgctgccgcagctccagcgcagggcg
gcgatggtcgaggacggcaccatcgactggggcatgggcgagaccctggccatcggctcg
ctgctgctggagggcgtcccggtccggctgtccggccaggactcccgccgcggcaccttc
ggccagcgccacgcggtgctgatcgaccgcgagaccggcgaggactacaccccgctgctg
tacctggccgacgagcaggcccgctacaacgtctacgactcgctgctctccgagtacgcg
gtcatgggcttcgagtacggctactcgctgacccgcccggacgcgctggtgatgtgggag
gcccagttcggcgacttcgccaacggcgcccagtcggtcatcgacgagtacatctcggcc
gccgagcagaagtggggccagacctccggcgtcacgctgctgctgccgcacggctacgag
ggccagggcccggaccactcctcggcccgcatcgagcgctacctccagctgtgcgcgcag
aacaacatgacggtcgcgatgccgaccctgccgtcgaactacttccacctcctgcggtgg
caggtgcacaacccgcaccacaagccgctggtggtcttcaccccgaagtcgatgctgcgc
ctgaaggccgccgcctcgaagacggaggagttcacgacgggtgagttccgcccggtcatc
ggcgacgactcggtcgacccgagcgccgtgaagaaggtcgtcttctgcgcgggcaaggtc
tactacgacctcgacgccgagcggaagaagcgcggcgcgacggacaccgcgatcatccgc
atcgagcgcctgtacccgctgccgggtgccgagctccaggcggagatcaagaagtacccg
aacgccgagaagtacctgtggacgcaggaggagccggcgaaccagggtgcctggccgttc
atcgcgctcaacctgatcgaccacctggacctggcggtcggcgcggacgtgccgcacagc
gagcggctgcgccgcatctcgcgtccgcactcctcctccccggccgtgggctccgccaag
cggcaccaggccgagcaggagcagctggtgcgcgaggtgttcgaggcgtga

DBGET integrated database retrieval system