KEGG   Streptomyces sp. SAT1: A8713_22680Help
Entry
A8713_22680       CDS       T04706                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00473  D-Alanine metabolism
strt00550  Peptidoglycan biosynthesis
strt01100  Metabolic pathways
strt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A8713_22680
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8713_22680
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A8713_22680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:strt01011]
    A8713_22680
Enzymes [BR:strt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A8713_22680
Peptidoglycan biosynthesis and degradation proteins [BR:strt01011]
 Precursor biosynthesis
  Amino acid ligase
   A8713_22680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ANH93624
UniProt: A0A1A9J460
LinkDB All DBs
Position
5228239..5229396
Genome map
AA seq 385 aa AA seqDB search
MSTENLPQSPEQPPRKPRVAVVCGGRSSEHGISVVTAGAVLRAIDRSKYEVLPIGITRDG
RWALTADDPDRMAITERRTPSVDDLAESGEGGVVLPVDPGNREVVYSEPGSVPKALGEVD
VVFPVLHGPYGEDGTLQGLLELSGVPYVGSGVLASAVGQDKEYMKRVFTSFGLKVGPYVV
IRPREWERDAPAARKKIVDFAGEHGWPLFVKPARAGSSIGITKVDDLSGLDEAVEEARRH
DPKVLVEAAVRGREIECGVLEFEDGPRASVPAEIPPPQEHAYYDFEAKYIDSTPGVVPAP
LTEEQTAEVRRLAVEAFEAASCEGLVRADFFLGEDGEFVINEINTMPGFTPISMYPKMWQ
ATGVSYEELVDRLIQAALDRSTGLR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagaacctcccccagagccctgagcagccgccgcgcaagccgcgggtggcc
gtcgtctgcggtggtcgcagctccgaacacgggatctccgtggtcaccgccggtgcggtg
ctgcgcgccatcgaccggagcaagtacgaggtcctgccgatcggcatcacccgcgacggc
cgctgggcgctgaccgcggacgacccggaccgcatggcgatcaccgagcggcgtacgccc
agcgtcgacgacctggccgagtccggcgagggcggcgtggtgctcccggtcgaccccggc
aaccgcgaagtcgtctacagcgagcccggttcggtgcccaaggcgctcggcgaggtcgac
gtcgtcttcccggtgctgcacggcccctacggcgaggacggcaccctccaggggctgctg
gagctgtccggtgtgccctatgtcggctcgggcgtgctcgcctcggccgtcggccaggac
aaggagtacatgaagcgggtgttcacctcgttcgggctcaaggtcggcccgtacgtggtg
atccggccgcgcgagtgggagcgggacgccccggcggcccggaagaagatcgtggacttc
gcgggcgagcacggctggccgctgttcgtgaagcccgcccgcgccggttcctccatcggc
atcaccaaggtcgacgacctctccggcctggacgaggccgtcgaggaggcccggcgccac
gacccgaaggtgctcgtggaggccgcggtgcgcggccgggagatcgagtgcggggtgctg
gagttcgaggacggcccgcgcgcctccgtgcccgccgagatcccgccgccgcaggagcac
gcgtactacgacttcgaggccaagtacatcgactccacgcccggcgtcgtgccggccccg
ctcaccgaggagcagaccgccgaggtgcggcggctcgcggtcgaggcgttcgaggcggcc
tcctgcgagggactggtccgcgcggacttcttcctcggcgaggacggcgagttcgtgatc
aacgagatcaacaccatgcccggcttcacgccgatctcgatgtacccgaagatgtggcag
gccaccggcgtctcctacgaggaactggtggaccgcctgatccaggcggccctggaccgc
tccaccggcctgcgctga

DBGET integrated database retrieval system