Streptomyces sp. SAT1: A8713_24170 Help Entry A8713_24170       CDS       T04706                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism strt  Streptomyces sp. SAT1 Pathway strt00261   Monobactam biosynthesis strt01100   Metabolic pathways strt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A8713_24170  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:strt01008]     A8713_24170 Polyketide biosynthesis proteins [BR:strt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A8713_24170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANH95640 UniProt:  A0A1A9J9U7 LinkDB All DBs Position 5625917..5626138 Genome browser AA seq 73 aa AA seqDB search MGPSDAAAPGEPGHLVLAGPAGRRSLWPRWLPVPPGWSTAYGPAPYDDCLHRLDAPPPRP ASPDQVRTRDPRP NT seq 222 nt NT seq  +upstreamnt  +downstreamnt ctgggcccgtccgacgcggccgcacccggcgagcccggccacctggtcctcgccggaccg gccggccgccgctcgctgtggccgcgctggctgcccgtcccgcccggctggagcaccgcg tacggcccggccccgtacgacgactgcctgcaccggctcgacgcgcccccgccccggccc gcgtccccggaccaggtccggacccgggacccccggccctga

DBGET integrated database retrieval system