KEGG   Streptomyces sp. SAT1: A8713_26220Help
Entry
A8713_26220       CDS       T04706                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00250  Alanine, aspartate and glutamate metabolism
strt00410  beta-Alanine metabolism
strt00640  Propanoate metabolism
strt00650  Butanoate metabolism
strt01100  Metabolic pathways
strt01120  Microbial metabolism in diverse environments
Module
strt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A8713_26220
   00650 Butanoate metabolism
    A8713_26220
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A8713_26220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8713_26220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strt01007]
    A8713_26220
Enzymes [BR:strt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A8713_26220
Amino acid related enzymes [BR:strt01007]
 Aminotransferase (transaminase)
  Class III
   A8713_26220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANH94249
UniProt: A0A1A9J5T1
LinkDB All DBs
Position
6126493..6127776
Genome map
AA seq 427 aa AA seqDB search
MNDLYDRHRAVLPDWLSLYYEDPLEITHGEGRYVWDAAGRRYLDFFGGILTTMTAHALPE
VTKAVSEQAARIVHSSTLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEANDTALLLAT
ALRRSNTVLAMRNSYHGRSFSAIGVTGNRSWSPSSLSPLQTLYVHGGVRTRGPFAHLDDA
GFVAACVEDLRDLLGHTRPPAALIAEPIQGVGGFTSPPDGLYAAFREVLAEHGVLWIADE
VQTGWGRTGDHFWGWQAHGRSGPPDIVTFAKGIGNGMSIGGVVARAEIMNCLDANSISTF
GGTQITMAAGLANLNHLVEHDLQGNARRVGGLLIERLRAVAARLPGVREVRGRGLMIGVE
LVRPGTDEADPRAAAAVLEAARERGLLIGKGGGHATSALRIAPPLSLTVAEAEEGAALLE
DALRAAY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctacgaccgtcaccgggccgtcctgcccgactggctctccctctactac
gaggacccgctggagatcacccacggcgagggccggtacgtctgggacgcggcgggccgc
cgctacctggacttcttcggcgggatcctgaccaccatgaccgcccacgcgctgcccgag
gtcaccaaggcggtgagcgagcaggccgccaggatcgtgcactcctcgaccctctacctc
aaccggccgatggtcgaactggccgaacgcatcgcccagttgagcggcatcccggacgcc
cgggtgttcttcaccacctcgggcaccgaggccaacgacaccgcgctgctgctggccacc
gccctccggcgcagcaacacggtcctggccatgcgcaacagctaccacggccgctccttc
agcgcgatcggcgtcaccggcaaccgctcctggtcgcccagctccctctccccgctccag
acgctctacgtccacggcggcgtccgcacccgcggacccttcgcccacctggacgacgcc
ggcttcgtcgcggcctgcgtcgaggacctcagggacctcctcggccacacccggccgccc
gccgcgctcatcgccgaaccgatccagggcgtcggcggcttcacctccccgcccgacggc
ctgtacgcggccttccgcgaggtcctcgcggagcacggcgtcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcgcacggccgc
agcggaccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggggtcgtcgcccgagccgagatcatgaactgcctggacgccaacagcatctccaccttc
ggcggcacccagatcaccatggccgcgggcctcgccaacctcaaccacctggtcgaacac
gacctccagggcaacgcgcgccgggtcggcggcctgctcatcgagcggctgcgggccgtc
gccgcccggctgcccggcgtacgcgaggtgcgcggccgcggactcatgatcggcgtcgaa
ctggtcaggcccggcaccgacgaggccgacccgcgggcggccgccgccgtgctggaggcg
gcccgcgagcgcggcctgctcatcggcaagggcggcggccacgccaccagcgccctgcgc
atcgccccgccgctgtcgctgaccgtcgcggaggccgaggagggcgccgccctgctggag
gacgcgctgcgcgcggcgtactga

DBGET integrated database retrieval system