KEGG   Streptomyces sp. SAT1: A8713_26420Help
Entry
A8713_26420       CDS       T04706                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00250  Alanine, aspartate and glutamate metabolism
strt00410  beta-Alanine metabolism
strt00430  Taurine and hypotaurine metabolism
strt00650  Butanoate metabolism
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01120  Microbial metabolism in diverse environments
strt02024  Quorum sensing
Module
strt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A8713_26420
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A8713_26420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8713_26420
   00430 Taurine and hypotaurine metabolism
    A8713_26420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A8713_26420
Enzymes [BR:strt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A8713_26420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DotU Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANH94279
UniProt: A0A1A9J5X1
LinkDB All DBs
Position
6176145..6177575
Genome map
AA seq 476 aa AA seqDB search
MTVRHSRDDRGDSRDLAVNPVFSREPLQVPRYALPRAEMDPDTAYQIVHDELMLDGNARQ
NLATFVSTWAEPQARRLMDECAEKNMIDKDEYPQTAEVETRCVHMLARLWHAEDPRRAIG
CSTTGSSEAAMLGGLALKRRWQHRRRAEGKPADRPNLVMGINVQICWEKFADYFEVEPRY
VPMEGDRYHLTPEQAVELCDENTIGVVAVLGSTFDGSYEPVAAIAAALDDLQARTGLDIP
IHVDGASGGMIAPFLDPDLEWDFRLPRVASINTSGHKYGLVMPGVGWALWRDKKALPDDL
VFHVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGFEGYRRVQQTCRDVATRLAAEIAR
LGPFELITDGSEIPVFAFRMSAGTDHFSVFDVSAALRESGWLVPAYTFPKNRTDLAVLRI
VVRNGFSHDLADLLLADLRRVLPRLDKQNEPHRTADDAGGFAHGAETKNPRSPGRD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaggcattctcgtgacgaccggggcgacagccgtgacctggcggtcaacccg
gtcttcagccgcgagccccttcaggtgccgcggtacgcgctgccccgggcggagatggac
ccggacacggcgtaccagatcgtgcacgacgagctgatgctcgacggcaacgcccggcag
aacctggcgacgttcgtctccacctgggccgagccgcaggcgcggcggctgatggacgag
tgcgccgagaagaacatgatcgacaaggacgagtacccgcagaccgccgaggtcgagacg
cggtgcgtccacatgctcgcccggctctggcacgccgaggacccgcgccgggcgatcggc
tgctccaccaccggttccagcgaggcggccatgctgggcgggctcgcgctcaagcgccgc
tggcagcaccggcgccgcgccgagggcaagcccgccgaccggcccaacctggtcatgggc
atcaacgtccagatctgctgggagaagttcgccgactacttcgaggtcgagccgcgctac
gttccgatggagggggaccgctaccacctcacccccgagcaggccgtcgagctgtgcgac
gagaacaccatcggggtggtcgcggtcctcggctccaccttcgacggcagctacgagccc
gtcgccgccatcgccgccgcgctcgacgacctccaggcccgcaccggcctggacatcccg
atccatgtcgacggcgcctccggcgggatgatcgcgcccttcctcgacccggacctggag
tgggacttccggctgccgcgggtcgcctccatcaacacctccgggcacaagtacgggctc
gtcatgcccggcgtcggctgggccctgtggcgggacaagaaggccctccccgacgacctc
gtcttccacgtcaactacctcggcggcgacatgccgaccttcgcgctgaacttctcccgg
cccggcgcccaggtcgtcgcgcagtactacaacttcctgcggctgggcttcgagggctac
cggcgcgtccagcagacctgccgcgacgtcgccacccggctcgccgccgagatcgcgcgg
ctcggcccgttcgagctgatcacggacggcagcgagatcccggtcttcgcgttccggatg
agcgcgggcaccgaccacttcagtgtcttcgacgtctccgccgcgctgcgcgagagcggc
tggctggtgcccgcgtacaccttcccgaagaaccgcaccgatctggccgtgctgcggatc
gtggtccgcaacggcttcagccacgacctcgccgatctgctcctggccgatctgcgccgc
gtcctgccccggctggacaagcagaacgagccgcaccgcaccgccgacgacgccggcggg
ttcgcgcacggcgcggagaccaagaacccacgcagccccggccgcgactga

DBGET integrated database retrieval system