KEGG   Streptomyces sp. SAT1: A8713_27125Help
Entry
A8713_27125       CDS       T04706                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
strt  Streptomyces sp. SAT1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANH94402
UniProt: A0A1A9J3K9
LinkDB All DBs
Position
complement(6330510..6331574)
Genome map
AA seq 354 aa AA seqDB search
MELPVMPPVKPMLAKPVARIPPGMHYEAKWDGFRAIVFRDGAEVELGSRTGKPLTRYFPE
LVAAFRERLPERCVLDGEIVIAREGRLDFDALTERIHPADSRVRALAERTPASFVAFDLL
ALDAETLLDVALADRRALLERALAGAGAPVHVAPATTDIDVARQWFEQYEGAGLDGVIAK
PPGLPYLQDQRAMFKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDGRGVLQHVGVAAA
FPMKRRAELIEELAPLRMDDPAGHPWAAWSEEAAHESARLPGAPSRWSGRKDLSWVPLRP
ERVAEVAYDHMENGARFRHTARFRRWRPDRAPESCTYAQLEEPVRYDLARILGP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcccgtgatgccgcccgtgaagcccatgctcgccaagccggtggcgcgcatc
ccgccggggatgcactacgaggcgaagtgggacgggttccgggcgatcgtgttccgcgac
ggggccgaggtcgagctgggcagccggacgggcaagccgctgaccaggtacttcccggag
ctggtcgcggcgttccgggagcggctgcccgagcggtgcgtgctggacggggagatcgtg
atcgcgcgtgaggggcggctcgacttcgacgcgctgaccgagcggatccatccggccgac
tcgcgggtgcgcgcgctggcggagcggaccccggcctccttcgtggcgttcgacctgctg
gcgctggacgccgagaccctgctcgacgtagcgctggcggaccggcgggcgctgctggag
cgggcgctcgcgggggcgggggcgccggtgcacgtggcgccggcgacgacggacatcgac
gtggcccggcagtggttcgagcagtacgagggggccgggctcgacggggtgatcgccaag
ccgccggggctgccctacctccaggaccagcgggccatgttcaagatcaagcacgagcgg
acggcggacgtggtggtggccggctaccgcctgcacaagagcggcccggtcgtgggctcg
ctgctgctcgggctctacgacggccggggcgtcctccagcacgtgggagtggcggcggcg
ttcccgatgaagcggcgcgccgaactgatcgaggagctggcgccgttgcgcatggacgat
ccggccgggcatccgtgggccgcgtggtccgaggaggcggcgcacgagtcggcccggctg
ccgggcgcgccgagccgctggtctggccgcaaggacctgtcgtgggtgccgctgcggccg
gagcgggtggccgaggtggcgtacgaccacatggagaacggggcccggttccggcacacg
gcgcgctttcgccgctggcgcccggaccgggccccggagagctgcacgtacgcccagctg
gaggagcccgtccgctacgacctggcgcggatcctcggcccctga

DBGET integrated database retrieval system