KEGG   Streptomyces sp. SAT1: A8713_28155Help
Entry
A8713_28155       CDS       T04706                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00020  Citrate cycle (TCA cycle)
strt00480  Glutathione metabolism
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01120  Microbial metabolism in diverse environments
strt01130  Biosynthesis of antibiotics
strt01200  Carbon metabolism
strt01210  2-Oxocarboxylic acid metabolism
strt01230  Biosynthesis of amino acids
Module
strt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8713_28155
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A8713_28155
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A8713_28155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ANH94573
UniProt: A0A1A9J492
LinkDB All DBs
Position
complement(6562416..6564635)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVRAYASQAGVAVETRDISLAGRIIAVFPEYLSEDQ
RIPDALTELGELAKTPEANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPKSDEER
DIRARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMGADD
FRSTEKSVVIAEDGALRIELKGDDGSTTVLRESVPVLAGEVVDASVMRVAALREFLTEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAKYGEAFAAAGLTPNDGLGGI
HKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEHDTLAVLPDSSYAGVYQAVIEDCRAHGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPVTGTVRLVDQAGNAVLEQAVSAGDIFRACQTKDAPVKDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVKQYLPEHDTEGLDIRILAPEEATRLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAEATGNTRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELARQTDDADLAKAFAQLAETLAGSEQQIVDELNAVQGEPADIGGYYQPDPAK
AAAVMRPSATWNEALAALS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacacacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccgggcgtacgcctcgcaggcgggtgtggccgtggagacccgt
gacatctcgctggccgggcgcatcatcgcggtgttcccggagtacctgagcgaggaccag
cggatccccgacgcgctgaccgagctgggcgagctggccaagacgcccgaggccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgcgatcgccgagctg
cagggccagggctacgcgctgccggactacccggacgacccgaagagcgacgaggagcgc
gacatccgcgcccgctacgacaagatcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagacgaacgtggcgaccatgggcgccgacgac
ttccgctccaccgagaagtccgtcgtcatcgccgaggacggcgcgctgcgcatcgaactg
aagggcgacgacggctccaccaccgtgctgcgcgagtcggtgccggtcctcgcgggcgag
gtcgtcgacgcctccgtgatgcgggtcgccgcgctgcgcgagttcctgaccgagcaggtc
gcccgcgccaaggcggagggcgtgctgttctccgtgcacctgaaggccaccatgatgaag
gtctccgacccgatcatcttcggccacgtcgtccgcgccttcttcccgaagacgttcgcg
aagtacggcgaggccttcgccgccgcgggcctgaccccgaacgacggcctgggcggcatc
cacaagggcctggagagcctgccggagggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgacaagggcatcaccaacctgcat
gtgccctccgacgtgatcgtggacgcctccatgccggccatgatccgcacctccggccac
atgtggggccccgacggccaggagcacgacaccctcgcggtgctgccggactcctcctac
gcgggcgtctaccaggccgtgatcgaggactgccgcgcccacggcgcctacgacccctcg
acgatgggctcggtgccgaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcccggtcaccggcacggtccgcctggtcgaccaggccggc
aacgcggtcctggagcaggccgtctcggccggtgacatcttccgcgcctgccagaccaag
gacgcgccggtcaaggactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaaggtg
aagcagtacctgccggagcacgacaccgagggcctggacatccggatcctggccccggag
gaggcgaccaggctgtcggtggagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctctcggtggtcccgctgatggcgggcggcggcctcttcgagaccggcgcc
ggcggctccgcgcccaagcacgtgcagcagctggtcaaggagaactacctgcgctgggac
tccctcggcgagttcttcgccctggtgccgtccctggagcagtacgccgaggccaccggc
aacacccgtgccaaggtcctcgccgacaccctcgaccgggccacggcgaccttcctcaac
gaggacaagtcccccacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctctccctgtactgggcgcaggagctggcccggcagaccgacgacgccgacctggccaag
gcgttcgcgcagctcgccgagaccctcgcgggcagcgagcagcagatcgtcgacgagctg
aacgccgtccagggcgagccggccgacatcggcggctactaccagcccgacccggccaag
gccgccgcggtgatgcgtccttcggccacctggaacgaggccctggccgccctgagctga

DBGET integrated database retrieval system