KEGG   Streptomyces qaidamensis: A4E84_09150Help
Entry
A4E84_09150       CDS       T04777                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00061  Fatty acid biosynthesis
stsi00780  Biotin metabolism
stsi01100  Metabolic pathways
stsi01130  Biosynthesis of antibiotics
stsi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A4E84_09150
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A4E84_09150
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A4E84_09150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:stsi01004]
    A4E84_09150
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A4E84_09150
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A4E84_09150
Lipid biosynthesis proteins [BR:stsi01004]
 Fatty acid synthase
  Component type
   A4E84_09150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AMW09647
UniProt: A0A143BWN9
LinkDB All DBs
Position
complement(2097030..2097797)
Genome map
AA seq 255 aa AA seqDB search
MSGILEGKRVLITGVLTESSIAFHTAKLAQEQGAEIILTAFPRPTLTERIAKKLPKPTKV
IELDVTNDEHLGRLADIVGEELGGLDGVVHSIGFAPQDALGGNFLNTPFESVATAMHVSA
YSLKSLTMACLPLMQNGGSVVGLTFDAQFAWPQYDWMGPAKAALEATSRYMARDLGKQNI
RCNLVSAGPLGSMAAKSIPGFGELASVWDDRSPLEWDLKDPEPAGRGVVALLSDWFPKTT
GEIIHVDGGLHAIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattctcgagggcaagcgcgtcctgatcaccggtgtgctgacggagtcctcc
atcgccttccacaccgccaagctggcccaggagcagggcgccgagatcatcctcacggcg
ttcccgcggccgacgctgaccgagcgcatcgccaagaagctgcccaagcccaccaaggtc
atcgagctcgacgtgacgaacgacgagcacctcggccggctcgccgacatcgtcggcgag
gagctcggcggcctcgacggggtcgtccactccatcggcttcgccccgcaggacgccctc
ggcggcaacttcctcaacacgccgttcgagtcggtcgccacagccatgcacgtctcggcg
tactccctgaagtcgctcaccatggcctgcctgccgctcatgcagaacggcggctccgtc
gtcggcctgaccttcgacgcgcagttcgcctggccgcagtacgactggatgggcccggcc
aaggccgccctggaggccaccagccgctacatggcccgtgacctgggcaagcagaacatc
cgctgcaacctggtctcggccggtccgctcggctccatggccgccaagtccatcccgggc
ttcggcgagctggcgtccgtgtgggacgaccgctccccgctggagtgggacctgaaggac
cccgagccggccggccgcggcgtcgtcgccctgctgagcgactggttccccaagaccacg
ggcgagatcatccatgtcgacggcggtctgcacgccatcggagcctga

DBGET integrated database retrieval system