KEGG   Streptomyces qaidamensis: A4E84_17120
Entry
A4E84_17120       CDS       T04777                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00997  Biosynthesis of various secondary metabolites - part 3
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    A4E84_17120
Enzymes [BR:stsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     A4E84_17120
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: AMW11075
UniProt: A0A143C222
LinkDB
Position
complement(3912726..3913706)
AA seq 326 aa
MTAFGHFARSLRLRRLYRHSTAGLMITPLDHSISDGPVAPKGTSLDHLAGQLAAGGADAV
VVHKGSVRHISPERFAAMSLIIHLNASTSQALDPDAKYVVTQVEEALRLGADAVSVHVNV
GSDDERQQIGDLGRIADACDRWNLPLLAMVYPRGPRVTDPRDPDLVAHAVTVASDLGADL
VKTVFLGSTAEMLDLTAACPVPVLVAGGPAMPTEEDVLAYVRDALAGGAGGVAMGRNIFQ
ASDPRRLAAKVARLIHHFPEQHFAPLAFPADAHRAERLTPDHLDAPAHPGAPGSPLDHDT
HHLSDPSYSSHPTGGPHHDGRKTVLA
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaccgcattcggccacttcgccaggtcactgaggctgcggcggctctaccgccacagc
acggcaggcctgatgatcacccctctcgaccactcgatcagcgacgggcccgtcgcaccc
aagggcaccagcctcgaccacctcgccgggcagctcgccgccggcggcgcggacgcggtc
gtcgtgcacaagggcagcgtccggcacatcagcccggagcggttcgccgcgatgtcgctg
atcatccatctcaacgcgtccaccagccaggcgctcgaccccgacgccaagtacgtggtg
acgcaggtcgaggaggccctccggctcggcgcggacgcggtgagcgtccacgtcaacgtc
ggctccgacgacgagcggcagcagatcggcgacctcggacggatcgccgacgcctgcgat
cggtggaacctgccgctgctcgccatggtgtacccacgcggcccccgggtgaccgacccg
cgcgacccggacctggtggcgcacgccgtcaccgtcgcctccgacctgggcgccgacctg
gtcaagaccgtcttcctcggctcgaccgcggagatgctcgacctgaccgccgcctgcccg
gtgcccgtactcgtcgcgggcggccccgcgatgcccaccgaggaggacgtcctggcctac
gtccgcgacgccctggccggcggcgcgggcggggtggcgatgggccgcaacatcttccag
gcctccgacccgcggcggctcgccgccaaggtcgcccggctgatccaccacttcccggag
cagcacttcgccccgctcgccttcccggccgacgcacaccgggccgagcggctgaccccc
gatcacctggacgccccggcccaccccggcgcgcccggctccccgctcgaccacgacacg
caccacctctccgacccttcgtactcctcacacccgacaggaggtccgcatcatgacgga
cgcaaaactgtgctggcttga

DBGET integrated database retrieval system