KEGG   Streptomyces qaidamensis: A4E84_21825Help
Entry
A4E84_21825       CDS       T04777                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00380  Tryptophan metabolism
stsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    A4E84_21825
Enzymes [BR:stsi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A4E84_21825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AMW11906
UniProt: A0A143C340
LinkDB All DBs
Position
4910028..4911251
Genome map
AA seq 407 aa AA seqDB search
MSEQAERAQKLDAVDELAGKRAEFVVDDVVYLDGNSLGALPAVVPARVEDVVRRQWGELR
IRSWEESGWWTAPERIGDRIAPLVGAAPGQIVVGDSTSINVFKALVGAVRMAGEGRDELL
VDATTFPTDGYIAESAARMTGCTLRPVAPADVPGALGDRTAAVLLNHVDYRTGRLHDLPG
LTAAVRAAGAVAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAYLYVRRELQ
DRFDSPLPGWNSHAEPFGMRSDFEAAPGALRGRVGTPDILSMLALEAALEVWDGVTVEAV
RAKSLALTDFFLECVAAYVPEGRVECVTPVAHGERGSQIALRCSPELSTSFEQGSAPIAD
AVMKRLIERGVVGDFRAPDVLRFGFTPLYVGFADVERAARVLAETLA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaggcggaacgcgcgcagaagctggacgccgtcgacgaactggccggcaag
cgcgcagagttcgtcgtcgacgacgtggtctacctcgacggcaactcgctcggtgccctg
cccgccgtcgtccccgcccgggtcgaggacgtcgtacgccgccagtggggcgagctgcgc
atccggtcctgggaggagagcggctggtggacggcgcccgagcggatcggggaccggatc
gccccgctggtcggggcggcgcccgggcagatcgtcgtgggcgactccacaagtatcaat
gttttcaaggcacttgtcggcgcggtgcggatggccggggagggccgtgacgagctcctc
gtcgacgcgacgaccttccccaccgacgggtacatcgccgagtccgccgcccgcatgacc
ggctgcaccctgcggcccgtggcacccgcggacgtcccgggcgcgctgggtgaccgcacc
gccgccgtcctcctcaaccacgtcgactaccgcaccggccggctgcacgacctgcccggt
ctgacggccgccgtgcgcgcggcgggcgcggtcgccgtctgggacctgtgccacagcgcg
ggcgccctgccggtcgggctggacgagcacggtgtggacctcgcggtcggctgcacctac
aagtacctgaacggcgggcccggttcaccggcgtacctgtatgtgcgccgggagttgcag
gaccgcttcgactcgccgctgccgggctggaactcgcacgccgagccgttcgggatgcgg
agcgacttcgaggccgcccccggcgccctgcgcggccgggtcggcacgcccgacatcctc
tccatgctcgccctggaggcggctcttgaggtgtgggacggggtgacggtcgaggcggtg
cgggccaagtccctcgcgctgacggacttcttcctggagtgcgtggcggcgtacgtgccc
gagggccgggtcgagtgcgtgacgccggtggcgcacggggagcggggcagccagatcgcc
ctgcgctgttcccccgagctctccacttcgttcgagcagggaagtgcccccatcgccgat
gccgtgatgaagcggctgatcgagcggggtgtggtcggtgacttccgggccccggacgtg
ctgcgcttcggcttcacaccgttgtacgtcgggttcgccgacgtggagcgggcggcgcgg
gtgctggcggagacgctggcctga

DBGET integrated database retrieval system