KEGG   Streptomyces qaidamensis: A4E84_23960
Entry
A4E84_23960       CDS       T04777                                 

Definition
(GenBank) dehydrogenase
Organism
stsi  Streptomyces qaidamensis
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-ProteinID: AMW12278
UniProt: A0A143C4C4
LinkDB
Position
5388416..5389825
AA seq 469 aa
MTAVGWLPSDAEELFGPDATAEESYEVLTVEVPPAAWITALETARDRLGCTYFDWLSAVD
EPGTGFHVMAHVAALSPLRCLLLRTTVPHEAPALPCAVGVYAGAAWHERETYEMFGITFE
GHPALDHLLLPENFEGHPLRKDFVLAARVAKAWPGAKEPGESEHGGPKRRQMLPPGVPDP
NEWGPLKGQLPPAPTRGAGRAGGDRPTRGAARPAGERPVRRARSVSEGSASQSAAGEGTP
AGGAETPTGSAGASAGGAGASAGPRRVRSAAEGSVSQSTPGESAAPAPAGPRRNRSASQG
SASQQPGGPASPEPGSASPATGPESARPGSESARPGSASPASDAPWHHARPAFDEPAPET
APEATKSPAPGPSEGSPTSPASEPAGAPESSETPESPDTPEFSSRPESPDATHAADAADA
ADAADATDAADAADVQDSVTEPQPTDDDVKPAGSPNKPDNPEDPAGGPQ
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaccgccgtcggctggctgccctcggacgccgaggagctcttcggcccggacgccacg
gccgaggagtcctacgaggtcctgaccgtcgaggtacccccggccgcctggatcaccgcc
ctggagaccgcccgcgaccggctcggctgcacctacttcgactggctgagcgcggtcgac
gaaccgggcacgggcttccacgtcatggcccacgtcgcggccctgtccccgctgcgatgc
ctcctcctgcgtacgacggtccctcacgaggctcccgccctgccctgcgccgtcggcgtc
tacgcgggtgccgcctggcacgagcgcgagacgtacgaaatgttcggcatcaccttcgaa
ggccacccggcgctggaccacctgctcctgccggagaacttcgaaggccaccccctgcgc
aaggacttcgtcctggccgcccgcgtcgccaaggcctggcccggcgcgaaggaaccgggc
gagtcggaacacggcggcccaaagcgccgccagatgctcccgcccggcgtccccgacccc
aacgaatggggccccctcaagggccagctcccgcccgcccccacccgaggcgcgggccgc
gcaggaggcgaccgccccacccgaggcgcagcccgccccgcaggggaacgcccggtacgg
cgcgcgcgctcggtgtcggagggctccgccagtcagtcggcggctggtgaggggacgccg
gccggcggcgcggagacgccgaccggcagcgcgggggcttcggctggtggtgcgggggct
tcggccggtccgcgtcgggtgcgttctgccgctgagggttcggtgagccagtccacgcca
ggtgagtcggcggctccggctccggcgggcccgcggcgcaaccgctcggcgtcgcagggg
tcggcgagtcagcaacccggtggcccggcatcgccggagcccggctccgcgtcccccgcg
accggccccgagtccgcgaggcccggttccgagtccgcgaggcccggttccgcgtccccg
gcctccgatgccccctggcaccacgcccgcccggccttcgacgaaccggcccccgaaacg
gcaccggaggcaacgaagtcaccggccccggggccgtcggaggggtcgccgacctcgccg
gcctccgagcccgcgggggcaccggagtcctcggagacacccgagagcccggacacaccg
gagttctcgagccgacccgagagcccggatgccacgcacgccgcggatgccgcggatgcc
gcggatgccgcggacgccacggatgccgcggacgccgcggatgtacaggactcggtgacg
gagccgcagcccacggatgacgacgtcaagcccgccggcagcccgaacaagcccgacaat
cccgaggaccccgcaggaggcccgcagtga

DBGET integrated database retrieval system