KEGG   Streptomyces sp. S10(2016): A4E84_26990Help
Entry
A4E84_26990       CDS       T04777                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
stsi  Streptomyces sp. S10(2016)
Brite
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A4E84_26990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AMW12812
UniProt: A0A143C5W6
LinkDB All DBs
Position
complement(6048559..6048954)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAANDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagtgctcactgcgaccttccctgc
ggtgtgtacgaccccgcccaggcccgcatcgaggcggagtcggtgaaggccgtgcaggag
aagatggccgccaacgacgacccgcacttccaggcgcgcgccaccgtcatcaaggagcag
cgcgccgagctcgccaagcaccacgtctcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaagggctcgaccgacccggccaccggccagaaggctctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system