KEGG   Streptomyces qaidamensis: A4E84_30595Help
Entry
A4E84_30595       CDS       T04777                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
stsi  Streptomyces qaidamensis
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A4E84_30595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMW13470
UniProt: A0A143C8M5
LinkDB All DBs
Position
complement(6896791..6897579)
Genome map
AA seq 262 aa AA seqDB search
MRRWGRSARDGWERAGAHTLVRQGRDVELLHRAMGFATLALVTLAPLLIVVAAADPLGRG
GFASWLADGMGLSGRSARLLTDIISPPRKVIGTTSVLGGVALAVFGVAFGGSVQNGYERI
WGLLSGPWHRVWRQAVWMIAMTAYLYQEVQTRSLTSGAERIALSSASGVLFFWWGQHFLL
GGQVRWRYLLPGAVATMAGLGGLRMFSYFVFSPLIVTNAISYGAVGVVLVVESWLIGVGY
VVYGGALLGRWVQEHHGFRYGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcggtgggggcgctcggcgcgcgacgggtgggagcgggccggtgcgcacaccctc
gtccggcagggccgcgacgtggagctgctgcaccgggccatggggttcgccacgctcgcg
ctggtcacactggcaccgctgctgatcgtggtcgccgccgccgacccgctgggacggggc
ggcttcgcgtcgtggctggccgacggcatggggctgtccgggcggtccgcgcggttgctc
accgacatcatcagcccaccgcgcaaggtcatcggcaccacgagcgtgctcggcggggtc
gcgctcgccgtcttcggtgtcgcgttcggcggcagcgtgcagaacggctacgagcggatc
tgggggctgctctccggcccctggcaccgggtctggcggcaggcggtgtggatgatcgcg
atgaccgcgtacctgtaccaggaggtgcagacccggagcctcacctcgggagccgagcgg
atcgcgctgagctcggcgtccggggtgctgttcttctggtgggggcagcacttcctgctg
ggcggtcaggtccgctggcgctatctgctccccggggcggtggccaccatggcggggctg
ggcggcctgcgcatgttctcctacttcgtcttcagtcccctcatcgtcaccaacgccatc
agctacggagcagtcggcgtcgtcctcgtcgtggagtcctggctgatcggcgtgggctac
gtcgtctacggcggggcactgctcggccgctgggtccaggagcaccacggattccggtac
ggccggtag

DBGET integrated database retrieval system