KEGG   Streptomyces sp. S10(2016): A4E84_33405Help
Entry
A4E84_33405       CDS       T04777                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
stsi  Streptomyces sp. S10(2016)
Pathway
stsi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:stsi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A4E84_33405
Enzymes [BR:stsi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A4E84_33405
DNA repair and recombination proteins [BR:stsi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A4E84_33405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AMW13965
UniProt: A0A143CAJ2
LinkDB All DBs
Position
7617921..7618880
Genome map
AA seq 319 aa AA seqDB search
MSGGDGTRRVRAGRRTVEVHRPDKVLFPGGGDAKEYTKADLVDYYRAVAPFMLPHLRGRP
LMLERHPDGIDGPTFMQKNTPDHYPEWIPRVEVAKEGGTVRHTVCDDTATLLYLADQASI
TLHRWLSRADSVDHPDRLVFDLDPPPVPEGPGGTPRDDFEAVREAARQLGELLDELDLPS
ALMTTGSRGLHVIVPLNGRHDFDEVRAFARDVADTLADAHPDRLTTAARKKERGERLYLD
IQRNAYAQTAVAPYTVRPRPGAPVAVPVTWDQLDDPELHARRWTLADAVEQARTDPWSGL
LNRGRALGPARRRLNALRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtggcgacggcacgcgcagggtgcgggcgggccgccgcacggtggaggtgcac
cggccggacaaggtgctcttccccggcggcggcgacgccaaggagtacaccaaggccgac
ctggtggactactaccgggctgtcgcgcccttcatgctgccgcacctgcgcggccggccg
ctgatgctggagcggcaccccgacggcatcgacggcccgacgttcatgcagaagaacact
ccggaccactacccggagtggatcccgcgtgtcgaggtggccaaggagggcggcaccgtc
cgtcacaccgtgtgcgacgacaccgcgaccctcctctacctggccgaccaggcgagcatc
accctgcaccgctggctgtcccgcgccgacagcgtcgaccaccccgaccggctggtgttc
gacctcgaccctcccccagtgcctgaagggcctggggggacccccagggacgacttcgag
gccgtgcgtgaggccgcccgccagctcggggagctgctcgacgagctcgacctgccctcc
gcgctgatgaccaccggctcacgcgggctgcacgtgatcgtgccgctgaacggccggcac
gacttcgacgaggtgcgcgccttcgcccgggacgtcgccgacaccctcgccgacgcccac
cccgaccggctcaccaccgccgcccgcaagaaggagcgcggcgagcggctctacctcgac
atccagcgcaacgcctacgcccagaccgccgtcgcgccctacacggtccggccccgcccg
ggcgcgccggtggcggtccccgtcacctgggaccagctggacgacccggagctgcacgcc
cgccgctggacccttgccgacgccgtcgagcaggcccggacggacccctggtcaggcctg
ctgaaccggggccgggcgctgggaccggcccggcggcggctgaacgccctgcgcggctga

DBGET integrated database retrieval system