KEGG   Streptomyces qaidamensis: A4E84_34480Help
Entry
A4E84_34480       CDS       T04777                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
stsi  Streptomyces qaidamensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMW14152
UniProt: A0A143C9P3
LinkDB All DBs
Position
complement(7863366..7864430)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVLPMLAKSVAAIPAGMQYEAKWDGFRAIVFRDGDEVELGSRTGKPLTRYFPE
LVTAVRERLPERCVVDGEIVIAREGHLDFDALTERIHPADSRVRTLAERTPASLVVFDLL
ALGDESLMDVPLTERRERLTGALSGERAPVHLAPATTDIEVARRWFEEYEGAGLDGVIAK
PLTVRYRPDERAMFKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDRGALQHVGVSAA
FTMKRRAELVEELEPLRLDDVTGHPWAAWSEEAAHETARLPGAPSRWSGRKDLSWVPLRP
DRVAEVAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccccccgtcctgccgatgctcgccaagtccgtggcggcgatc
cccgcgggcatgcagtacgaggcgaagtgggacgggttccgggcgatcgtgttccgtgac
ggggacgaggtcgagctgggcagccgcaccgggaagcctctgaccaggtactttcccgag
ctggtgacggctgtgcgggagcggttgccggagcggtgcgtggtggacggggagatcgtg
atcgcgcgggaggggcatctggacttcgacgcgctgacagagcggatccacccggcggac
tcgcgggtgcggacgctggccgagcggacaccggcttcgctcgtcgtgttcgatctgctg
gcgctgggcgacgagtcgctgatggacgtcccgctgacggagcggcgggagcggctgacc
ggggcgctgtccggggagcgggcgccggtgcacctggcgccggcgaccaccgacatcgag
gtggcgcggcggtggttcgaggagtacgagggggccgggctcgacggggtcatcgccaag
ccgctgacggtgcgctaccggccggacgaacgcgccatgttcaagatcaagcacgagcgg
acggcggatgtcgtggtcgccgggtaccgcctgcacaagagcggccccgtggtgggttcg
ctgctgctcggcctgtacgacgaccggggcgccctccagcacgtgggtgtgtccgccgcc
ttcacgatgaagcggcgtgccgagctggtcgaggagctggagccgctgcgcctggacgac
gtgacggggcatccgtgggcggcctggtccgaggaggccgcgcacgagacggcccggctg
ccgggggcgccgagccgctggtcgggccggaaggacctgtcgtgggtaccgctgcggccg
gaccgggtggccgaggtggcgtacgaccacatggagaacgggcagcgtttccggcacacc
gcccgtttccgccgctggcgcccggaccggacccctgagagctgtacgtacgcgcagctg
gaggagccggtccgttacgacctggcggagatcctcggcgtctag

DBGET integrated database retrieval system