KEGG   Streptomyces sp. S10(2016): A4E84_35295Help
Entry
A4E84_35295       CDS       T04777                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
stsi  Streptomyces sp. S10(2016)
Pathway
stsi00020  Citrate cycle (TCA cycle)
stsi00480  Glutathione metabolism
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
stsi01120  Microbial metabolism in diverse environments
stsi01130  Biosynthesis of antibiotics
stsi01200  Carbon metabolism
stsi01210  2-Oxocarboxylic acid metabolism
stsi01230  Biosynthesis of amino acids
Module
stsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stsi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4E84_35295
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4E84_35295
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A4E84_35295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AMW14299
UniProt: A0A143CAP4
LinkDB All DBs
Position
complement(8044385..8046604)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVRAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAVAELQGQGYALPDYPDDPKTDEER
EIRARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKSHPHRMGAWTAESKTNVATMGQND
FRSTEKSVVIAEDGALRIELVGDDGTTTVLRESVPVLAGEVVDASVMRVAALREFLTAQV
AKAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAQYGDKLAAAGLTPNDGLGGI
WKGLDSLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEHDTLAVLPDSSYAGVYQAVIDDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEVPATGTVRLVDGNGTALIEQAVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVNTYLAEHDTEGLDIRILNPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSFEQLAKVAGNARAQVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAGQSDDADLAKAFAPLAETLAANEQKIVDELSAVQGKPVDIGGYYQPDPAK
AAEAMRPSTTWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggcccccgccctggcgacgtat
tccttcctgccggtggtccgggcgtacgcgtcgcaggccggtgtcgccgtggagacccgc
gacatctcgctggccgggcgcatcatcgccgtgttcccggagtacctgaccgaggaccag
cgcatcccggacgccctcgcggagctcggtgagctggccaagacgcccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggcggccgtcgccgagctg
cagggccagggctacgccctgccggactacccggacgacccgaagaccgacgaagagcgc
gagatccgcgcccgctacgacaagatcaagggctccgccgtgaacccggtcctgcgtgag
ggcaactccgaccggcgtgccccggcctcggtcaagaactacgccaagtcccacccgcac
cgcatgggcgcctggaccgccgagtccaagaccaacgtggcgaccatggggcagaacgac
ttccgctccaccgagaagtccgtcgtgatcgccgaggacggcgccctgcgcatcgagctc
gtcggcgacgacggcaccaccacggtgctgcgcgagtccgtacccgtgctcgccggtgag
gtcgtcgacgcctccgtgatgcgcgtcgccgcgctgcgcgagttcctgaccgcgcaggtc
gccaaggccaaggccgagggcgtgctgttctcggtgcacctgaaggcgacgatgatgaag
gtctccgacccgatcgtcttcggccacgtggtgcgcgccttcttcccgaagacgttcgcg
cagtacggcgacaagctcgccgcggccggcctcaccccgaacgacggtctgggcggcatc
tggaagggcctcgactcgctgccggagggtgccgagatcaaggcctccttcgacgccgag
ctcgccgagggcccggagctggcgatggtcgactccgacaagggcatcacgaacctgcac
gtcccgtcggacgtcatcgtcgacgcctccatgccggccatgatccgcacctcgggccac
atgtggggccccgacggccaggagcacgacaccctcgcggtcctgccggactcgtcctac
gcgggcgtctaccaggccgtgatcgacgactgccgggccaacggcgcctacgacccgtcc
accatgggctcggtgccgaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgaggtccccgccacgggcaccgtccgcctggtcgacggcaacggc
accgcgctcatcgagcaggccgtctcggccggcgacatcttccgcgcctgccagaccaag
gacgccccgatccgggactgggtcaagctggccgtcacccgcgcccgtgccaccggcgac
ccggcggtgttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaaggtc
aacacctacctcgccgaacacgacaccgagggcctggacatccggatcctcaacccggtc
gaggcgacgaagctgtcggtggagcgcatccgccgcggcgagaacacgatctcggtcacc
ggcaacgtcctgcgtgactacctgaccgacctcttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggtgcg
ggcggctcggcgccgaagcacgtgcagcagctggtcaaggagaactacctgcgctgggac
tccctgggtgagttcttcgccctggtgccgtccttcgagcagctcgcgaaggtggcgggc
aacgcccgcgcccaggtcctggccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccgggcagagcgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctcgccgcgaacgagcagaagatcgtcgacgagctg
agcgccgtgcagggcaagccggtcgacatcggcggctactaccagcccgaccctgcgaag
gccgcggaggccatgcgcccgtccaccacgtggaacgaggccctggcctccctgagctga

DBGET integrated database retrieval system