KEGG   Streptomyces qaidamensis: A4E84_35760Help
Entry
A4E84_35760       CDS       T04777                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00020  Citrate cycle (TCA cycle)
stsi00190  Oxidative phosphorylation
stsi00650  Butanoate metabolism
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
stsi01120  Microbial metabolism in diverse environments
stsi01130  Biosynthesis of antibiotics
stsi01200  Carbon metabolism
Module
stsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
stsi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4E84_35760 (sdhA)
   00650 Butanoate metabolism
    A4E84_35760 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A4E84_35760 (sdhA)
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A4E84_35760 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     A4E84_35760 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMW14382
UniProt: A0A143CAB7
LinkDB All DBs
Position
8162226..8164175
Genome map
AA seq 649 aa AA seqDB search
MTSYADYTTGEPVSDTKAPAGPINERWDKRRFEAKLVNPANRRKHTVIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSVHRLFYDTVKGGDFRAR
ESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALSRQIAAGNIEMHPRTEMLDLIVVDGRARGIVARDLVTGKIDTYFADAVVLASGGY
GNVFYLSTNAMNSNATAIWRAHRRGALFANPCFTQIHPTCIPRTGDHQSKLTLMSESLRN
DGRIWVPKAKGDQRPANDIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIARMGRGAVQAKYGNLFDMYQRITDEDPYEVPMRIYPAVHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPSTINDYLARHPHHDTV
TDEHPDVQEVLAGTQDRLHLLLSAGGDRTPDSFHREVGELMWEFCGMARTDAGLRKALER
IPQIREEFWRRIKVPGTGEEFNQSLEKANRIVDYLELAELMCLDALHREESCGGHFREES
QTPDGEAAREDEQFAYAAAWEFTGTGEAPVLHKEDLVFEYVHPTQRSYA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctacgccgactacacgaccggggaaccggtctccgacaccaaggcccccgcc
gggccgatcaacgagcgctgggacaagcgccgcttcgaggccaagctggtcaaccccgcc
aaccggcgcaagcacaccgtgatagtcgtcggcaccggcctcgccggcggctccgccggg
gccaccctcgccgaacagggctaccacgtcgtccagttctgctaccaggactcgccccgc
cgcgcccactccatcgccgcgcagggcggcatcaacgccgcgaagaactaccgcaacgac
ggcgactccgtccaccgcctgttctacgacacggtcaagggcggcgacttccgggcccgc
gagtccaacgtgcaccggctcgcgcagatctccgtcgagatcatcgaccagtgcgtggcc
cagggcgtgcccttcgcccgcgagtacggcggcctgctcgacacccggtcgttcggcggc
gtgcaggtgtcgcgcacgttctacgcccgcggccagacgggtcagcagctcctcctcggc
gcctaccaggccctcagccggcagatcgcggccgggaacatcgagatgcacccgcgcacc
gagatgctcgacctgatcgtcgtcgacgggcgggcgcgcggcatcgtcgcccgggacctg
gtcacggggaagatcgacacgtacttcgcggacgccgtcgtcctcgcctccggcggctac
ggcaacgtcttctacctgtcgacgaacgccatgaactccaacgccaccgccatctggcgg
gcccaccggcgcggcgccctgttcgccaacccctgcttcacccagatccaccccacctgc
atcccgcgcaccggcgaccaccagtccaagctgacgctgatgagcgagtcgctgcgcaac
gacgggcgcatctgggtgccgaaggccaagggcgaccagcggcccgcgaacgacatcccc
gaggacgagcgcgactactacctggagcgcatctacccctccttcggcaacctcgtcccg
cgggacatcgcctcgcgcgccgcgaagaacgtgtgtgacgagggcaggggagtgggcccc
ggcggccagggcgtctacctcgacttcgccgacgccatcgcccgcatgggacggggggcg
gtccaggccaagtacggcaacctcttcgacatgtaccagcggatcaccgacgaggatccg
tacgaggtaccgatgcggatctacccggccgtgcactacacgatgggcggcctgtgggtc
gactacgacctccagaccaccgtccccgggctgttcgcgatcggcgaggccaacttctcc
gaccacggagccaaccgcctcggcgcctccgcgctgatgcagggactcgcggacggctac
ttcgtccttccctcgaccatcaacgactacctggcccgccacccgcaccacgacacggtg
accgacgaacaccccgacgtccaggaggtgctggccggcacacaggaccgcctccacctg
ctgctgtccgccggcggcgaccgcacccccgactccttccaccgcgaggtcggcgaactc
atgtgggagttctgcggcatggcccgcaccgacgcgggactgcgcaaggcgctggagcgc
atcccgcagatccgcgaggagttctggcggcgcatcaaggtgcccggcaccggcgaggag
ttcaaccagtcgctggagaaggccaaccgcatcgtcgactacctggagctcgccgagctg
atgtgcctcgacgcgctgcaccgcgaggagtcctgcggcggccacttccgcgaggagtcc
cagacgcccgacggcgaggccgcccgcgaggacgagcagttcgcctacgccgccgcctgg
gagttcaccggcacgggcgaagctccggtgctgcacaaggaagacctggtcttcgagtac
gtccaccccacccagcggagctacgcatga

DBGET integrated database retrieval system