KEGG   Streptomyces qaidamensis: A4E84_35765Help
Entry
A4E84_35765       CDS       T04777                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00020  Citrate cycle (TCA cycle)
stsi00190  Oxidative phosphorylation
stsi00650  Butanoate metabolism
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
stsi01120  Microbial metabolism in diverse environments
stsi01130  Biosynthesis of antibiotics
stsi01200  Carbon metabolism
Module
stsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
stsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
stsi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4E84_35765
   00650 Butanoate metabolism
    A4E84_35765
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A4E84_35765
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A4E84_35765
    1.3.5.4  fumarate reductase (quinol)
     A4E84_35765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_17 Fer4_10 Fer4_18 Fer4 Fer4_16 Fer4_2 Fer4_4 Fer4_15 Fer4_6 Fer4_3 Fer2 Fer4_21 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AMW14383
UniProt: A0A143CAB0
LinkDB All DBs
Position
8164172..8164918
Genome map
AA seq 248 aa AA seqDB search
MKLTLRVWRQRNADADGTMSTYEVDGISPDMSFLEMLDTLNEELIVKGDDPVAFDHDCRE
GICGACSLVINGDAHGPERTTTCQLHMRSFQDGDTIDVEPWRASAFPVIKDLVVDRSAFD
RIIQAGGYITAPTGAAPEAHATPVPKPDADFAFEHAECIGCGACVAACPNGAAMLFTSAK
INHLNVLPQGAPERETRVLDMVEQMDEEGFGGCTLAGECATACPKGIPLMSITSMNKEWL
RAARKAKR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaccctgcgcgtctggcggcagcggaacgccgacgccgacggcacgatgtcc
acgtacgaggtggacgggatctcgcccgacatgtcgttcctggagatgctcgacacgctc
aacgaggaactcatcgtcaagggcgacgacccggtcgccttcgaccacgactgccgggag
ggcatctgcggcgcgtgctcgctcgtcatcaacggcgacgcgcacggccccgagcggacg
acgacctgccagctgcacatgcggtcgttccaggacggcgacacgatcgacgtcgagccg
tggcgggcgtcggccttcccggtgatcaaggacctcgtcgtggaccggtcggccttcgac
cggatcatccaggccggcgggtacatcaccgcgccgacgggtgcggctcccgaggcgcac
gccacgccggtgccgaagccggacgccgacttcgccttcgagcacgccgagtgcatcggg
tgcggggcgtgcgtggcggcctgcccgaacggggcggcgatgctgttcacctcggcgaag
atcaaccacctcaacgtgctgccgcagggggcgcccgagcgcgagacgcgggtgctggac
atggtggagcagatggacgaggaggggttcggcgggtgcacgctcgcgggcgagtgcgcc
accgcgtgcccgaagggcatcccgctgatgtccatcacgagcatgaacaaggagtggctg
cgcgctgcgcggaaggctaagcggtag

DBGET integrated database retrieval system