KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0228Help
Entry
t0228             CDS       T00121                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristol acyl carrier protein dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00061  Fatty acid biosynthesis
stt00780  Biotin metabolism
stt01100  Metabolic pathways
stt01212  Fatty acid metabolism
Module
stt_M00083  Fatty acid biosynthesis, elongation
stt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    t0228 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    t0228 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:stt01004]
    t0228 (fabZ)
Enzymes [BR:stt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     t0228 (fabZ)
Lipid biosynthesis proteins [BR:stt01004]
 Fatty acid synthase
  Component type
   t0228 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AAO67958
UniProt: P0A1I0
LinkDB All DBs
Position
263409..263864
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagagcttctgccgcaccgt
tttccgtttttactggtcgatcgcgtgctggactttgaagaaggtcgttttctgcgtgcg
gtgaaaaatgtctccgtcaacgagccgtttttccaggggcatttcccgggcaaaccgatt
ttgccaggcgtgctgattctggaagcgatggcgcaggcaaccggtattctggcgtttaaa
agcgttggtaaactggaacctggcgaactgtattatttcgcgggtattgatgaagcgcgc
tttaagcgtccggtggtgccaggcgatcagatgatcatggaagtcactttcgagaaaacg
cgccgtggcctgacccgctttaaaggggttgcgctggtcgacggtaaagttgtgtgcgaa
gcaaccatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system