KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0381Help
Entry
t0381             CDS       T00121                                 

Definition
(GenBank) putative exported protein
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    t0381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:stt01002]
    t0381
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:stt01011]
    t0381
Enzymes [BR:stt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     t0381
Peptidases and inhibitors [BR:stt01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   t0381
Peptidoglycan biosynthesis and degradation proteins [BR:stt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   t0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AAO68099
UniProt: Q8Z4S7
LinkDB All DBs
Position
complement(455340..456638)
Genome map
AA seq 432 aa AA seqDB search
MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQIDAGYPSINL
LVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNFALQKLVYEG
KIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKNVAGKLFSQS
KSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTIYKPLGLKHT
VFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSMGGVSGHAGL
FSDTHDMAVLMQVMLNGGGYGNVKLFDNKTVAQFTRRSPEDATFGLGWRVNGNASMTPTF
GVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFVSGLLPAATY
GWIVDQIYGSLK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttactctcgttgcgacggttctactgacgttttccctttcagcttttgccgtt
gagtatccggtattgaccaccgcgagccctgatcaggtggggtttgatagccaaaaactt
caccgacttgatggctggattcaaaatcaaattgatgccggatatcccagcatcaatctt
ctggtgataaaagataatcatattgttctacaaaaagcctggggctatgccaaaaaatat
gacggttccacgctgttagcccatcccattcgggcgaccactaacacgatgtatgacctg
gcttcaaacacaaaaatgtatgccactaactttgcattgcaaaaactggtgtatgaagga
aaaatagatgtcaatgatttggtatcaaaatatatccccggctttaaggatatgcctggg
gataaaataaaaggcaaagataaactccgcattattgatattcttcatcacgtcgcgggc
tttcctgccgacccacaatatcccaataaaaacgtcgccggtaaattattttcacagagt
aaaagcactactctggagatgattaaaaagacaccgctggaatatcaacctgggtcgaag
catatctacagcgacgtggattatatgattcttggttttatcattgaatcgataacggca
atgccattagatcgctacgtcgaaaccaccatttataaaccgctcggattaaaacatacc
gtctttaacccgctgatgaaaggcttcacgccgccgcaaatcgccgcaacggaactacac
ggcaacacgcgtgacggcgtgattcatttccccaatattcgcaccaatacactatggggc
caggtgcatgacgaaaaagcctggtactcaatgggcggcgtttcaggacacgccggactg
ttttctgacacccatgatatggctgtgttaatgcaagtcatgctcaatgggggcggctac
ggtaacgtgaagctattcgacaacaaaacggttgcgcagtttactcgccgctcgccagaa
gatgctacctttggtctggggtggcgcgttaacggcaacgcctcaatgaccccaacgttc
ggggtattagccagtccgcaaacgtatggacataccggatggaccggaacgctgacgtct
atcgatccggttaatcatatggcgattgttattttaggtaacaggccgcactcgccggta
gcaaatcctaaagtgaacccgaatgtttttgtcagtggattattacctgcggcgacgtat
ggctggattgttgaccagatatatggttccttaaaataa

DBGET integrated database retrieval system