KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0523Help
Entry
t0523             CDS       T00121                                 

Definition
(GenBank) putative transketolase N-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00030  Pentose phosphate pathway
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01200  Carbon metabolism
stt01230  Biosynthesis of amino acids
Module
stt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
stt_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    t0523
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    t0523
Enzymes [BR:stt01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     t0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-ProteinID: AAO68229
UniProt: Q8Z518
LinkDB All DBs
Position
594765..595595
Genome map
AA seq 276 aa AA seqDB search
MNVTEITQLARDIRVATLKSLNHLGFGHYGGSMSVVETLAVLYGAVMKIDPADPDWPERD
YFVLSKGHAGPALYSTLAIKGYFPREELNTLNQNGTRLPSHPDRLKTHGVDATTGSLGQG
ISIAGGMALSHKLARRPNRVFCIVGDGELNEGQCWEAFQFIAHHRLNNLTVFIDWNKQQL
DGELEEIINPFDLEGKFRAFGFDVVTVKGDDIAGLLAVVQPVPPADARPRVVILDSIKGQ
GVPCLEQLTNSHHLRLTDGMKQTLNEAIHQLEVMHD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaccgaaatcacccaactggcgcgcgacattcgcgtcgccacgctcaaatcc
ttaaaccatcttggctttggtcactatggcggcagcatgtcggtagtggagactctggcg
gttctgtacggcgcggtgatgaaaatcgaccctgccgacccggactggccggagcgcgat
tacttcgtactgtcgaaaggccatgcgggccccgcgttgtacagtaccctggcgattaaa
ggctatttcccgcgcgaagagctgaatacgcttaaccagaacggcacccgtcttcccagc
catccggatcggctaaaaacgcacggcgtggacgccacgaccggctcactgggacaaggc
atctctattgcgggcggaatggcgttgtcgcataaactggcgcggcgacccaaccgggta
ttttgcattgtcggcgatggggagctgaatgaagggcagtgctgggaggcgtttcagttt
attgcccaccaccgcctgaataatctgaccgttttcattgactggaacaaacaacagctt
gacggcgagctggaggagattatcaatccattcgatctggaagggaaattccgcgcgttt
ggtttcgatgtcgtcaccgtcaaaggcgatgatatcgccggactactggcggtggttcag
cctgtgccgcccgctgatgcccggccacgggttgtgatccttgacagcattaaagggcag
ggggtgccatgcctggagcagttaacgaattctcaccacttacgcctgacggatggcatg
aagcagacgctcaatgaggccattcatcaactggaggtcatgcatgattaa

DBGET integrated database retrieval system