KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2072Help
Entry
t2072             CDS       T00121                                 

Definition
(GenBank) putative inner membrane protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stt02000]
    t2072
Transporters [BR:stt02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    t2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane_2 ABC2_membrane ABC2_membrane_4
Motif
Other DBs
NCBI-ProteinID: AAO69692
UniProt: Q8XGS9
LinkDB All DBs
Position
2135313..2136443
Genome map
AA seq 376 aa AA seqDB search
MSKSLSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGYGINLDSSKLRVGILLE
QQSQEALDFTHAMTGSPYIDATISDNRHELIEKMQAGRIRGLVVIPVDFAQQMARDGDSA
PIQVITDGSEPNTANFVQGYVEGIWQIWQQQRAEDRGDTFEPLIDVQTRYWFNPAAISQH
FIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLSTEVTRVELLLCKLIPYYFLGMLA
MLLCMLVSVFILGVPYRGSLVILFIITSLFLLSTLGMGLLISTITRNQFNAAQVALNAAF
LPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVSTLQSLFLAGNIPVVLGVNVLFLIASA
VMFIGLTWLKTKRRLD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctctctcctggcgccgcgtgcgtgcgttgtgcgtcaaagagacgcgccag
atcgtgcgcgatcccagtagctggctgattgcggtggtgatcccgctgctgttgctgttt
atttttggttacggcattaacctcgactccagcaagctgcgggtggggattctgcttgaa
cagcaaagccaggaggcgctggatttcactcatgcgatgaccggttcaccctatatcgac
gcgaccattagcgataatcgtcatgaattaattgaaaaaatgcaggccggacgcattcgc
ggactggtggtgattccggtggatttcgcgcagcaaatggcgcgcgacggtgacagcgcg
ccgattcaggtgattaccgacggcagcgagccaaataccgccaacttcgttcagggctat
gttgaaggcatctggcaaatctggcaacagcagcgcgcggaagatcgcggcgacaccttt
gaaccgcttatcgacgtccagacgcgctactggtttaacccggcggcgatcagtcagcat
tttatcattcccggggcggtgaccattatcatgacggtaattggcgccatcctcacctcg
ctggtcgttgcccgcgaatgggaacgcggcacgatggaggcgctgctctcaaccgaagtg
acgcgtgttgaactgctgctgtgtaagcttattccctattattttctcggtatgctggcg
atgctgctctgtatgctggtatcggtgtttattctcggcgtgccgtatcgcggttcgctg
gtaattctgtttatcatcaccagtctgtttttactgagtacgctggggatggggctgttg
atttccaccatcactcgcaaccagtttaacgccgcgcaggtggcgctgaacgccgcgttt
ttgccttcgattatgctgtccggatttatcttccagatagacagtatgcctgcggtgatc
cgcgcggtgacctatattattccggcgcgctattttgtcagcaccctgcaaagtctgttt
ctggccggcaatattccggtcgtgttaggcgttaacgtactgtttttaatcgcctcggcg
gtgatgtttattggcctgacgtggctaaaaaccaaacgacggctggattaa

DBGET integrated database retrieval system