KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3987Help
Entry
t3987             CDS       T00121                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00564  Glycerophospholipid metabolism
stt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    t3987 (glpD)
Enzymes [BR:stt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     t3987 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 3HCDH_N Pyr_redox_2 FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AAO71457
UniProt: Q8Z230
LinkDB All DBs
Position
complement(4131754..4133262)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccggacgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgca
acctcttccgccagttcgaaacttatccacggcggcttacgctaccttgaacactacgag
ttccgtctggtcagcgaagcgctggccgaacgtgaagtgctgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcacttacgtccagcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtactcaaacctgaaatcgtgcgcggattcgaa
tactccgactgctgggtagacgatgcgcgtctggtactggccaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggcccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccgtatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaaacaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacaaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtctataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggtgtccgtccgctgtgc
gatgatgagtccgactcgccgcaggcgatcactcgcgattatacccttgatatccatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggccgaacatgcgatggaaaaactggcgtcttattatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttatccgttcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcactgcttgatttaggcgaa
gatttcggtcatgagttttacgaagcggaactcaaatacttggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgag
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcactg
gcgtcctga

DBGET integrated database retrieval system