KEGG   Streptococcus thermophilus JIM 8232: STH8232_1824Help
Entry
STH8232_1824      CDS       T02026                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00473  D-Alanine metabolism
stu00550  Peptidoglycan biosynthesis
stu01100  Metabolic pathways
stu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    STH8232_1824 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH8232_1824 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    STH8232_1824 (ddlA)
Enzymes [BR:stu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STH8232_1824 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:stu01011]
 Precursor biosynthesis
  Amino acid ligase
   STH8232_1824 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK MsyB
Motif
Other DBs
NCBI-ProteinID: CCC20488
UniProt: F8LZ01
LinkDB All DBs
Position
complement(1521809..1522855)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLILLYGGRSAEREVSVLSAESVMRVVDYNAFEVKTYFITQSGDFIKTQEFIETPG
DDEKLMTNDTVEASQAIKPSDIYEEDAVVFPVLHGPMGEDGSIQGFLETLKLPYVGTNVL
SSSVAMDKIMTKRILEVAGVPQVAYTGYIEGEDLEAAVAETLEKLTFPVFVKPANMGSSV
GISKAENESELRSAIDLALKYDSRILIEQGVVAREIEVGILGNTTVKTTDPGEVVKDVAF
YDYQAKYIDNKITMDIPARVPVEVMTQMRAYAAKAFRALGGCGLARCDFFLTEDGAIYLN
ELNTMPGFTQWSMYPLLWENMGLSYSDLIKELVVLGQEMFDKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacccttatccttctctatggtggacgttcagcagaacgtgaagtgtct
gtactatcagctgagagtgttatgcgtgtggtagattacaacgcatttgaggttaaaacc
tactttatcactcagtctggtgattttatcaaaacacaagaatttatagaaaccccaggt
gatgatgagaagctcatgactaatgacactgttgaggctagtcaggctattaaaccaagc
gatatctacgaagaagatgctgtggtcttccctgtgcttcatggtcctatgggtgaggat
ggttctatccaaggtttccttgaaaccctcaagttgccatacgtggggaccaatgttctt
tcatcaagtgtagctatggacaagattatgaccaagcgtattcttgaagttgctggagtg
ccacaggttgcctacacaggctacatcgagggtgaagatttggaagcagcagtagcagag
acacttgaaaaattgaccttcccagtttttgtcaaaccagccaacatggggtcatctgtt
gggatttctaaagctgaaaatgaatcagagcttcgttcagcgattgatcttgctctcaaa
tatgatagccgtatcttgattgagcaaggtgtagttgctcgtgaaatcgaagttggtatc
cttggaaatacgactgtcaaaacgactgatccgggtgaagtggtcaaagacgtggctttc
tatgattaccaagccaagtacattgacaataagattaccatggatattccagctcgcgtg
cctgtcgaagtcatgacgcaaatgcgtgcctatgcggccaaggcctttcgtgctctaggg
ggttgcggtcttgcccgctgtgatttcttcctgacagaggatggagccatctaccttaat
gagctcaacaccatgccaggtttcactcaatggtcaatgtacccactactttgggaaaat
atgggactctcttactcagatcttatcaaggaattggtagttttgggacaagaaatgttc
gacaaacgtgaaagccatttgatttaa

DBGET integrated database retrieval system