KEGG   Spiroplasma turonicum: STURON_00181Help
Entry
STURON_00181      CDS       T04034                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
stur  Spiroplasma turonicum
Brite
KEGG Orthology (KO) [BR:stur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:stur01001]
    STURON_00181
Enzymes [BR:stur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     STURON_00181
Protein kinases [BR:stur01001]
 Serine/threonine kinases: Other
  Bacterial family
   STURON_00181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Haspin_kinase APH FTA2 Kdo
Motif
Other DBs
NCBI-ProteinID: AKU79427
UniProt: A0A0K1P6A8
LinkDB All DBs
Position
200949..201962
Genome map
AA seq 337 aa AA seqDB search
MQEYIKGDLLADRYQVIERLGKGGMASVYKSIDLYTKNIVAVKIISPEIVLKPAGQERFE
IEKEAFAKLGNNPYVVKLYDVFQSGSDWFIILENVDGGTLKDKYQQFGAMTLSEIKFYFT
KLCDALDNAHKLGIIHRDIKPDNVLLTKSGQVKLADFGISVMEGFESEAEKAIGTPKYMP
PEVIAAQKPTPQSDIYSLGIMLYEFSTGIAPFIGKDPKKIATRHIKESPTYPRLINPAIP
QSLENIILKMIEKEPNFRYQSAAEVKEDILKVRQTDIVKQYNYHNKILFINSSKSKKIKV
GTYYDKLPFIAKNKFSILLSFIILSFILAFALVLVFV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatatattaaaggagatttattagcagatagatatcaagttattgaaagactt
ggtaaaggtggaatggcatcagtttataagtcaattgatttgtatacaaaaaacattgta
gcagtaaaaattatatctcctgaaattgttctaaaacctgcagggcaagaaagatttgaa
attgaaaaagaagcttttgcaaagctgggaaataatccatatgtagttaaactttatgat
gtttttcaatcaggtagtgattgatttattattttagaaaatgttgacggtggaacttta
aaagataaatatcaacaatttggagccatgacgctttcagaaattaaattttattttact
aaattatgtgatgcacttgataatgctcataaacttggaataatacatcgtgacattaaa
cctgacaatgttctattaacaaaaagtggccaagtaaagttagctgattttggtatatca
gtaatggaaggttttgaatcggaagctgaaaaagcgataggtactcctaaatatatgcca
cccgaagtaatagcagctcaaaaaccaacgcctcaaagtgacatttattcattaggaatt
atgttgtatgagttttcaactggtattgcccctttcataggaaaagatcctaagaaaatt
gcaactagacatataaaagaaagtccaacatatccaagacttataaatccagcaatccca
caaagtttagaaaatataattcttaaaatgattgaaaaagaaccaaactttagatatcaa
tctgcagcagaagttaaagaagatatattaaaagtaagacaaacagatattgttaagcaa
tataattatcataataaaattttatttataaatagttcaaaatcgaaaaaaataaaagtt
ggtacttattatgataaacttccttttatagcaaaaaataaattctccattcttttatca
tttataatattatctttcatattagcttttgctcttgtcttagtctttgtttag

DBGET integrated database retrieval system