KEGG   Spiroplasma turonicum: STURON_00919Help
Entry
STURON_00919      CDS       T04034                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stur  Spiroplasma turonicum
Pathway
stur00010  Glycolysis / Gluconeogenesis
stur00030  Pentose phosphate pathway
stur00051  Fructose and mannose metabolism
stur00052  Galactose metabolism
stur00680  Methane metabolism
stur01100  Metabolic pathways
stur01110  Biosynthesis of secondary metabolites
stur01120  Microbial metabolism in diverse environments
stur01130  Biosynthesis of antibiotics
stur01200  Carbon metabolism
stur01230  Biosynthesis of amino acids
stur03018  RNA degradation
Module
stur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STURON_00919 (pfkA)
   00030 Pentose phosphate pathway
    STURON_00919 (pfkA)
   00051 Fructose and mannose metabolism
    STURON_00919 (pfkA)
   00052 Galactose metabolism
    STURON_00919 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    STURON_00919 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    STURON_00919 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:stur01009]
    STURON_00919 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:stur03019]
    STURON_00919 (pfkA)
Enzymes [BR:stur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STURON_00919 (pfkA)
Protein phosphatases and associated proteins [BR:stur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STURON_00919 (pfkA)
Messenger RNA biogenesis [BR:stur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     STURON_00919 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Radical_SAM NAD_kinase DAGK_cat Csa1 TcdB_N O-FucT
Motif
Other DBs
NCBI-ProteinID: AKU80165
UniProt: A0A0K1P7A0
LinkDB All DBs
Position
complement(1070822..1071793)
Genome map
AA seq 323 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAISSVVKAAISKSITPFVIRDGYKGLYNDWIEEVDTVFAND
IISRGGTIIGSARFPEFKEEEIRKVAVDNLKKRGIEALVVIGGDGSYQGAEKLTKMGINC
IGIPGTIDNDIVSSDYTVGFDTALNTVIRSIDSIRDTMQSHNRCSVVEIMGNGCGDLTLY
AAIATGAEVFSTKESFLTEEEVVNQVKELANKKKRSVIVAIAEKIYPDAHELAKKIESAS
GYVTRATVLGHVQRGGSPTGMDRYLAVNAGIFAVDQLVAGKGGLYIGMSENKLIARDIES
TLNMPRKDKSEEYQKIREINKAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattggtgttttaacatctgggggtgatgctcctggtatgaatgcagcg
atatcttcagttgtaaaagcagcgatatctaaatcaataactccttttgtaatcagagat
ggttataaaggactttataatgactgaattgaagaagtggatacagtttttgcaaatgat
attatttcaagaggtggaactattataggttctgctagatttcctgaatttaaagaagaa
gaaattagaaaagttgcagttgataatttaaaaaaaagagggatcgaagcattagttgta
attggtggtgatggaagttatcaaggagctgaaaaactaacaaaaatgggtattaattgt
ataggtatacctggaacaattgataatgatattgtttcatctgattatactgttggattt
gatactgcattaaatactgtaataagatcaattgattcaattagagacacaatgcaatct
cacaatagatgtagtgttgtagaaataatgggaaatggctgtggtgatttaactttatat
gctgcaatagcaactggagcagaagtattttcaacaaaagaaagttttttaactgaagaa
gaggttgttaaccaagttaaagaacttgctaacaagaaaaaaagaagtgttattgtggca
atagcagagaaaatatacccagatgcacatgaacttgctaaaaaaattgaatcagcatct
ggttatgtaactagagctacagttttgggtcatgttcaaagaggtggttcaccaaccggg
atggatagatatttagctgtaaatgctggtatatttgcagttgatcaattagttgcaggt
aaaggtggattatatattggaatgagtgaaaataaacttattgcaagagatattgagtca
acattaaatatgccaagaaaagataaatcagaagaatatcaaaaaataagagaaataaat
aaagctatatag

DBGET integrated database retrieval system