KEGG   Streptococcus sp. VT 162: V470_01090Help
Entry
V470_01090        CDS       T03287                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00250  Alanine, aspartate and glutamate metabolism
stv00290  Valine, leucine and isoleucine biosynthesis
stv01100  Metabolic pathways
stv01110  Biosynthesis of secondary metabolites
stv01130  Biosynthesis of antibiotics
stv01210  2-Oxocarboxylic acid metabolism
stv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    V470_01090
   00290 Valine, leucine and isoleucine biosynthesis
    V470_01090
   00220 Arginine biosynthesis
    V470_01090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stv01007]
    V470_01090
Enzymes [BR:stv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     V470_01090
    2.6.1.66  valine---pyruvate transaminase
     V470_01090
Amino acid related enzymes [BR:stv01007]
 Aminotransferase (transaminase)
  Class I
   V470_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AHZ47048
UniProt: A0A024DCV5
LinkDB All DBs
Position
212030..213244
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAAEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVDELAQIQEKMTRFLSQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcctatgatatccgtggtcct
gttttggaagaagctatgcggatgcgagcaaacggagaaaagattttacgtctgaataca
gggaatccagcagaatttggctttacagcgccagatgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaagggtactctgattccaagggtattttttcggcgcgtaaggct
atcatgcagtattgccaactgaagaaatttcccaatgtggacattgatgatatctacctt
ggaaatggtgtcagtgagctgattgttatgtccatgcaagggcttttggataatggcgat
gaggtcttggtgcctatgccagactatcctctctggacagccgcggtcagcctagctggg
ggaaatgccgttcactatatctgtgatgaggctgcagaatggtacccagatattgatgat
attaagtcaaaaattacttccaataccaaggcaatcgtccttatcaatccgaacaaccca
actggagccctttatcctaaggaactcttgttggagattattgagattgctcgtcaaaac
gatttgattatctttgcggatgagatttatgaccgcatggtgatggatgggcatgtgcat
acgcctgtggcgagcttggcacctgatgttttctgtgtcagcatgaatggtctgtcaaaa
tctcaccgtatcgctggttttcgtgtaggctggatggtcttgtctggtcctaagcaccat
gtcaagggttatatcgaagggctcaatatgctgtcaaatatgcgcctttgctccaacgtt
ttggcccagcaagtcgtacaaacatcactaggtgggcaccagtcagtggatgaattgctc
ctccctggtggacggatttacgagcaaagaaactttatctataatgccattcaagatatt
ccaggtttatctgcagtcaagcctaaggcgggtctttatatcttccctaaaattgaccgt
aatatgtaccgcattgatgatgatgaacagttcgttcttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgtggttttaactggaaggaaccagaccatttccgtatcgtt
taccttcctcgtgtggacgaattagcgcaaatccaagaaaagatgacacgtttcttgagt
cagtatcgtagataa

DBGET integrated database retrieval system