KEGG   Streptococcus sp. VT 162: V470_03285Help
Entry
V470_03285        CDS       T03287                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00627  Aminobenzoate degradation
stv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    V470_03285
Enzymes [BR:stv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     V470_03285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AHZ47460
UniProt: A0A024DF36
LinkDB All DBs
Position
689765..690538
Genome map
AA seq 257 aa AA seqDB search
MAYKGYLIDLDGTIYKGKDRIPAGEAFVHELQKREIPYLFVTNNTTRTPESVQEMLAQNF
NINTPLSTVYTATLATIDYMNDLGLEKTVYVIGEAGLKDAIQAAGYVEDKENPAYVVVGL
DWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGAGSLITLLEVATRVKPVYIG
KPNAIIMDKAVEHLGLKREELLMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVADLPI
APTHVVSSLAEWNFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaaggttatttaattgatttagacggaaccatttacaaggggaaagacaga
atcccggcaggtgaggcttttgtccatgagttgcaaaagcgagaaattccctatctcttt
gtaaccaacaatacaactcgtactcctgagagcgttcaagagatgttggctcagaatttt
aatatcaatacgcctctatcaactgtctacacggcaactttggcaactatcgactatatg
aatgacttgggactggaaaagacagtctatgtcatcggagaagcaggactcaaggatgcc
attcaggcagctggttatgtcgaagacaaggaaaatcctgcctatgtggtagttggactg
gactggcaagtcgactatgaaaaatttgcgacggcgactctagccattcaaaagggggct
cactttatcggaaccaatccagacctcaatatcccgacggaacgtggtcttttgccaggt
gctggttcactaattacacttcttgaagtagcaacacgggtaaaaccagtttatatcggg
aaaccaaatgctatcattatggataaggcagttgagcacttaggtttgaaaagagaagaa
ttgctcatggttggggacaactacctgacagatatccgagcagggattgacaatggcatt
ccaacgctcttagtgacaacaggttttaccaaggcagaagaagtggctgatctgccaatc
gcaccaactcatgtagtttctagccttgcggagtggaattttgatgaaaactaa

DBGET integrated database retrieval system