KEGG   Streptococcus sp. VT 162: V470_03400Help
Entry
V470_03400        CDS       T03287                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00500  Starch and sucrose metabolism
stv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    V470_03400
Enzymes [BR:stv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     V470_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AHZ47483
UniProt: A0A024DE19
LinkDB All DBs
Position
complement(711573..713021)
Genome map
AA seq 482 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLTNDAEHLANLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFQQKGTVRTKYGFKEDYLQAIQTLKAQGIQPMADVVLNHKAAADHMEAFQVIEVD
PEDRTVQLSEPFTINGWTHFTFDGRQDTYNDFHWHWYHFTGTDYDAKRRKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMGNFIRDMKEKYGQDFYVFGEFWNPDKEANLDYLEKTEERFDLVDVRLHQNLFEASQ
AGASYDLRNIFTDSLVELKPDKAVTFVDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQFAQQDFREVLDRLLAIRKDRAYGEQTDYFDDANCIGWVRSGAEHQ
SPIAVLISNDQENSKSMFVGQEWADQTFVDLLENHPAQVTINAEGYGEFPVAAGSVSVWA
TK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcagacacttatgcaatactttgaatggtatttgcctcacgacggccaacac
tggacgcgactgacaaatgatgcagagcacctagcaaaccttggtatcagccatgtctgg
atgccacctgccttcaaggcaaccaacgaaaaagatgtcggctatggtgtttacgatctt
tttgacctaggagaatttcagcaaaaagggactgtccgtaccaagtatgggtttaaagaa
gattatcttcaagccattcaaaccctaaaggcacagggaattcaacctatggccgatgtg
gtgctcaatcacaaggctgctgccgatcatatggaagcctttcaggttattgaagtggac
cctgaggaccgtaccgttcaactaagcgagccctttactatcaacggctggactcacttc
accttcgatggtcgccaagatacctacaatgacttccactggcactggtaccacttcaca
ggtacggactacgatgccaagcgacgtaagtctggcatttacctgatccagggagacaat
aaaggctgggcaaatgaggaattggtcgataacgaaaacggtaactacgactacctcatg
tatgctgacctagactttaagcatcctgaagtcatccaaaacatctatgactgggctgac
tggttcatggaaacgactggtgttgctggtttccgcttggatgccgttaagcacatcgac
tccttctttatgggcaatttcatccgtgatatgaaggaaaaatacggtcaagatttctat
gtttttggtgaattttggaatccagacaaggaagccaatctagactatctcgagaaaaca
gaagaacgctttgatcttgtcgatgttcgtctccaccagaacctctttgaagccagtcaa
gctggagcaagttacgaccttcgtaacattttcacagatagcttggttgaactcaagcct
gacaaagcagtcactttcgttgacaaccatgatacccaacgaggacaagcccttgagtct
actgttgaagaatggttcaagccagcagcctatgccctcattctattacgccaagatggt
cttccatgtgtcttttacggagactattacggcatttcagggcaatttgctcaacaagat
ttcagagaagttcttgatcgtctcctagccatccgaaaagacagggcatatggggagcaa
acagactactttgacgatgccaactgtatcggttgggttcgttcaggtgctgaacatcaa
tctccaatcgctgtcctcatctcaaatgaccaagaaaacagcaaatctatgtttgtcggg
caagaatgggctgaccaaacctttgttgacctccttgaaaatcatccagcacaagttaca
atcaacgctgaaggttatggagaatttccagtagcagcgggttcagtcagtgtttgggca
acaaaataa

DBGET integrated database retrieval system