KEGG   Streptococcus sp. VT 162: V470_05445Help
Entry
V470_05445        CDS       T03287                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00620  Pyruvate metabolism
stv00680  Methane metabolism
stv01100  Metabolic pathways
stv01120  Microbial metabolism in diverse environments
stv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V470_05445
  09102 Energy metabolism
   00680 Methane metabolism
    V470_05445
Enzymes [BR:stv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     V470_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHZ47868
UniProt: A0A024DF37
LinkDB All DBs
Position
complement(1105640..1108336)
Genome map
AA seq 898 aa AA seqDB search
MSLQKLENYSNKAVVQEEVLILTELLEDITKNMLAPETFEKIIQLKELSTSENYQGLNDL
VTSLSNEEMIYISRYFSILPLLINISEDVDLAYEINHQNNVDQDYLGKLSTTIKMVAEKE
NAAEILEKLNVVPVLTAHPTQVQRKSMLDLTNHIHTLLRKYRDVKLGLINKEKWHTDLRR
YIEIIMQTDMIREKKLKVTNEITNVMEYYQSSFLNAVPRLTAEYKKMAKEQGIDLQHPKP
ITMGMWIGGDRDGNPFVTAETLNKSALTQCEVIMNYYDEKIYNLYREFSLSTSIVNVSDK
VREMALKSQDNSIYREKELYRRALFDIQAKMQATKAYLIEDKELQPRYATADEFYQDLLA
IRDSLLENKGEYLISGEFVELMQAVEIFGFYLASIDMRQDSSVHEACVAELLASAGINDH
YSDLSEDEKCALLLKELEEDPRILSATHAEKSELLEKELSIFKTARKLKDKLGENVIRQT
IISHATSVSDMLELAIMLKEVGLVDAQKARVQIVPLFETIEDLDHSEETMRRYFSLPLAK
KWIASKDNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKVTFFHGRGGTV
GRGGGPTYEAITSQPLKSIKDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSAAINRMITK
KKSDTNTSNRYEAIMDQVVDRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFIDQDPKNIEFLRDMYQNWPFF
QSLLSNVDMVLSKSNMNIAFEYAKLCEDEEVQAIYYTILDEWQLTKDVILAIEGYDELLA
ENSYLKDSLNYRMPYFNILNYIQLELIKRQRRGELSADEEKLIHTTINGIATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttcaaaaattagaaaactatagtaataaagcagtcgtccaagaagaagtcttg
attctgactgagctattagaagatatcacaaaaaatatgctggcgccagaaacctttgaa
aagattatccagttgaaggaattatcaactagcgagaattatcaagggctcaatgaccta
gtgaccagtctttcgaatgaagaaatgatttacatttcacgctatttctctatccttcca
cttttgattaatatctctgaggatgtggatttggcctatgaaatcaatcaccaaaacaat
gtggaccaagactatctaggaaaactatctacaacgattaagatggtagctgaaaaagaa
aatgcagccgaaattttagaaaagttaaatgtcgttcctgtcttgaccgctcatccaacg
caagtacaacgcaagagtatgctggacttgaccaaccatatccatacgcttttgcgcaag
taccgtgatgtcaaactcggtttgattaataaagaaaaatggcacacggatctccgtcgt
tatattgaaattatcatgcaaacggacatgattcgtgagaaaaaattgaaagtaaccaac
gaaatcaccaacgtgatggagtattaccaaagttctttcctgaatgctgttccacgtttg
acagctgagtataaaaaaatggcaaaagaacaaggtatcgatctccaacatccaaaaccg
attaccatggggatgtggatcggaggagaccgtgatggaaatccttttgtaacagcggaa
actctcaataaatcagccttgactcagtgtgaagtcatcatgaactactatgatgaaaag
atttataatctttatcgtgaattttcactgtcaaccagcatcgtgaatgtcagcgacaag
gttcgtgagatggcgctgaagtcacaagataactccatttaccgtgaaaaagaactctat
cgtcgtgctctttttgacattcaagctaagatgcaggcaactaaggcttatctcattgaa
gacaaggaacttcagcctagatatgccactgcagatgaattttatcaagatttgttggcc
attcgggactctctccttgaaaacaaaggggaatacctgatttctggagaatttgtcgag
ttgatgcaagctgtcgaaatctttggcttctaccttgcctctattgacatgcgccaggat
tctagcgttcacgaagcctgtgtggctgaattgttagcatccgcaggaatcaacgaccac
tatagcgatctgtctgaagacgaaaaatgtgccctcctcttaaaagagttggaagaagat
cctcgtatcctctcagcgactcatgctgaaaagtcagaactgcttgaaaaagaactctct
atctttaaaactgcgcgcaagttgaaggataaactgggtgaaaatgttattcgtcaaacc
atcatttctcatgcaaccagtgtatccgatatgttagagctagccattatgcttaaggaa
gtcggcttggtggatgcccaaaaagcccgcgttcagattgttcctctctttgaaacgatt
gaagatttggatcactcagaagaaaccatgagaagatatttctctcttcctttggctaaa
aaatggattgcttcaaaagacaactaccaagaaatcatgcttggctattctgatagtaac
aaggacggaggatacctgtcatcatgttggactctctataaagcgcaacaacaactgact
gctattggagatgaatttggcgttaaggtcactttcttccacggtcgtggtggtactgtg
ggtcgtggtggtggaccaacttatgaagctatcacatctcaaccactcaagtctatcaag
gaccgtatccgtctgactgagcagggagaagtcattggaaacaaatacggtaacaaagac
gctgcttattacaaccttgaaatgttggtttctgcagccattaaccgtatgattaccaag
aagaagagtgataccaatacgtcaaatcgttacgaagctattatggaccaagtagtggat
cgtagttatgatatctatcgtgacttggtctttggaaatgaacatttctatgactatttc
tttgaatcaagcccaatcaaggctatttcaagtttcaatatcggttcgcgtccagcagct
cgtaagaccatcacagaaatcggtggtttgcgcgctatcccttgggtcttctcatggtca
caaagtcgtgtcatgttccctggatggtatggtgtaggatcaagctttaaagagtttatt
gatcaagatccgaagaatatcgagtttcttcgagatatgtaccaaaactggcctttcttc
caatctttgctttccaatgtagacatggtcttgtccaagtctaacatgaacattgctttt
gaatatgccaaactctgtgaagatgaagaagtgcaagctatctactacactattttagat
gaatggcagttgaccaaggatgttattttagctatcgaaggttatgatgaactcttagca
gaaaactcttacctaaaagacagcctaaactatcgtatgccttactttaatatccttaac
tacatccagttggagttgattaaacgtcaacgtcgcggcgaattgtcggcagacgaagaa
aaactgatccatacaactatcaacggaattgcaaccggtttgcgtaattcaggctga

DBGET integrated database retrieval system